Full name: Fibrillarin-like rRNA/tRNA 2′-O-methyltransferase
Synonym: aFib, PH0052, Fibrillarin-like
GI: 14590005
Orf:
COG: COG1889
UniProt: O57811
Structures: | 1G8A |
Complex: C/D RNP
Enzyme type: methyltransferase
Position of modification - modification: l:many - Xm
s:many - Xm

Comments:

Homologue of yeast Nop1 protein and human fibrillarin. A catalytic subunit of C/D RNP complex, which in Archaea is composed of FlpA (fibrillarin), L7Ae and Nop56/58 proteins.

Protein sequence:

MVEVKKHKFPGVYTVIDDDGSERIATKNLVPGQRVYGERVIKWEGEEYRIWNPNRSKLGAAIMNGLKNFP IKPGKSVLYLGIASGTTASHVSDIVGWEGKIFGIEFSPRVLRELVPIVEERRNIVPILGDATKPEEYRAL VPKVDVIFEDVAQPTQAKILIDNAEVYLKRGGYGMIAVKSRSIDVTKEPEQVFREVERELSEYFEVIERL NLEPYEKDHALFVVRKT

Links:

_Wikipedia_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto