Full name: Fibrillarin-like rRNA/tRNA 2′-O-methyltransferase
Synonym: aFib, Fibrillarin-like, PF0059
GI: 18976431
Orf:
COG: COG1889
UniProt: Q8U4M2
Structures: | 2NNW | 3NVM |
Complex: C/D RNP
Enzyme type: methyltransferase
Position of modification - modification: l:many - Xm
s:many - Xm

Comments:

Homologue of yeast Nop1 protein and human fibrillarin. A catalytic subunit of C/D RNP complex, which in Archaea is composed of FlpA (fibrillarin), L7Ae and Nop56/58 proteins.

Protein sequence:

MVEVKKHKFPGVYVVIDDDGSEKIATKNLVPGQRVYGERVIKWEGEEYRIWNPHRSKLGAAIVNGLKNFP IKPGKSVLYLGIASGTTASHVSDIVGWEGKIYGIEFSPRVLRELVPIVEERRNIIPILGDATKPEEYRAL VTKVDVIFEDVAQPTQAKILIDNAKAYLKRGGYGMIAVKSRSIDVTKEPEQVFKEVERELSEYFEVIERL NLEPYEKDHALFVVRKP

Publications:

Title Authors Journal Details PubMed Id DOI
Structure determination of fibrillarin from the hyperthermophilic archaeon Pyrococcus furiosus. Deng L, Starostina NG, Liu ZJ, Rose JP, Terns RM, Terns MP, Wang BC Biochem Biophys Res Commun [details] 14975761 -
Alternative conformations of the archaeal Nop56/58-fibrillarin complex imply flexibility in box C/D RNPs. Oruganti S, Zhang Y, Li H, Robinson H, Terns MP, Terns RM, Yang W, Li H J Mol Biol [details] 17617422 -
Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle. Xue S, Wang R, Yang F, Terns RM, Terns MP, Zhang X, Maxwell ES, Li H Mol Cell [details] 20864039 -

Links:

_Wikipedia_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto