Full name: Fibrillarin-like rRNA/tRNA 2′-O-methyltransferase
Synonym: aFib, Fibrillarin-like, AF_2087
GI: 11499669
Orf:
COG: COG1889
UniProt: O28192
Structures: | 1NT2 |
Complex: C/D RNP
Enzyme type: methyltransferase
Position of modification - modification: l:many - Xm
s:many - Xm

Comments:

Homologue of yeast Nop1 protein and human fibrillarin. A catalytic subunit of C/D RNP complex, which in Archaea is composed of FlpA (fibrillarin), L7Ae and Nop56/58 proteins.

Protein sequence:

MKELMRNVYLLDDTLVTKSKYGSHYGEKVFDGYREWVPWRSKLAAMILKGHRLKLRGDERVLYLGAASGT TVSHLADIVDEGIIYAVEYSAKPFEKLLELVRERNNIIPLLFDASKPWKYSGIVEKVDLIYQDIAQKNQI EILKANAEFFLKEKGEVVIMVKARSIDSTAEPEEVFKSVLKEMEGDFKIVKHGSLMPYHRDHIFIHAYRF

Publications:

Title Authors Journal Details PubMed Id DOI
Structural and thermodynamic evidence for a stabilizing role of Nop5p in S-adenosyl-L-methionine binding to fibrillarin. Aittaleb M, Visone T, Fenley MO, Li H J Biol Chem [details] 15286083 -
Structure and function of archaeal box C/D sRNP core proteins. Aittaleb M, Rashid R, Chen Q, Palmer JR, Daniels CJ, Li H Nat Struct Biol [details] 12598892 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto