Full name: Pre mRNA splicing protein
Synonym: Nop5, SSO0939
GI: 15897820
Orf:
COG: COG1498
UniProt: Q97ZH3
Structures: | 3ICX | 3ID5 | 3ID6 |
Complex: C/D RNP

Comments:

Nop56/58 protein together with L7Ae makes the core of C/D RNP complex in Archaea. It is a homologue of S. cerevisiae and mammalian Nop56 and Nop58 proteins.

Protein sequence:

MMKIYLIEHVIGAVAYDENGNIVDYITNPRDLGKITEELLNNEKGIPFSATVELLKKVNPQEVVVENEAE VPKLQALGYRVSYEPYSKVSRIFRESLPKVAIDIKFASNEEDYYNFLHELSLEYTRRKLRSAAQKRDLLA IQAVRAMDDIDKTINLFSERLREWYSIHFPELDKLIEDHEEYATIVSRFGDRGFLTIDSLKELGFNEQRI NRILDAAKKSIGADISEDDLSAMRMIANTILDLYNIRRNLNNYLEGVMKEVAPNVTALVGPALGARLLSI AGSLDELAKMPASTIQVLGAEKALFRALRSGGRPPKHGIIFQYPAIHTSPRWQRGKIARALAAKLAIAAR VDAFSGRFIGDQLNEQLKKRIDEIKEKFAQPPPKKPQQQKPQQPQKQQAKGKKGGKRRGKRK

Publications:

Title Authors Journal Details PubMed Id DOI
Structural organization of box C/D RNA-guided RNA methyltransferase. Ye K, Jia R, Lin J, Ju M, Peng J, Xu A, Zhang L Proc Natl Acad Sci U S A [details] 19666563 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto