Full name: Archaeal nucleolar protein homolog
Synonym: Nop5, AF_2088
GI: 11499670
Orf:
COG: COG1498
UniProt: O28191
Structures: | 1NT2 |
Complex: C/D RNP

Comments:

Nop56/58 protein together with L7Ae makes the core of C/D RNP complex in Archaea. It is a homologue of S. cerevisiae and mammalian Nop56 and Nop58 proteins.

Protein sequence:

MSKLRYNLWFGVYDGKEIKLSENFEESFLKAENPSPLPFNVSEVGAKALGKDYYRILRKTALAVSEKMVE KELRREDRYVVALVKALEEIDESINMLNEKLEDIRAVKESEITEKFEKKIRELRELRRDVEREIEEVMEK IAPNMTELVGAKVAAKLLERAGSMERLVRLPASKIQVIGAEKSLYKAFARMKKGKKAKIPKHGIIFLHPF IRTLPKAKRGKMARFLAAKLAIAAKIDYFRGEIDESLYESIRRRYEELRRK

Publications:

Title Authors Journal Details PubMed Id DOI
Structure and function of archaeal box C/D sRNP core proteins. Aittaleb M, Rashid R, Chen Q, Palmer JR, Daniels CJ, Li H Nat Struct Biol [details] 12598892 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto