Full name: 50S ribosomal protein L7Ae
Synonym: rpl7ae, MJ1203
GI: 15669389
Orf:
COG: COG1358
UniProt: P54066
Structures: | 1RA4 | 1XBI | 1SDS |
Complex: C/D RNP

Comments:

L7Ae protein, together with fused Nop56/58 (also designated Nop5) and Fibrillarin methyltranferase (FlpA), makes the core of C/D RNP complex in Archaea. It is a homologue of S. cerevisiae Snu13 and mammalian 15.5kD protein. Archaeal L7Ae is also a subunit of H/ACA RNP complex, a subunit of RNase P and one of the ribosomal protein of the 50S subunit. In all cases L7Ae binds to a common kink-turn motif of RNA.

Protein sequence:

MAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGI PYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ

Publications:

Title Authors Journal Details PubMed Id DOI
The crystal structure of the Methanocaldococcus jannaschii multifunctional L7Ae RNA-binding protein reveals an induced-fit interaction with the box C/D RNAs. Suryadi J, Tran EJ, Maxwell ES, Brown BA 2nd Biochemistry [details] 16008351 -
Structure of protein L7Ae bound to a K-turn derived from an archaeal box H/ACA sRNA at 1.8 A resolution. Hamma T, Ferre-D'Amare AR Structure [details] 15130481 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto