Full name: Ribosomal protein L7Ae
Synonym:
GI: 159111753
Orf: GL50803_11287
COG: COG1358
UniProt: A8BMJ0
Structures: | 3O85 |
Complex: C/D RNP

Comments:

15.5kD protein is a homologue of yeast Snu13 and archaeal L7Ae. Binds to a common kink-turn motif of RNA. Together with Nop56, Nop58 and fibrillarine they make the core of the heteromeric C/D RNP complex. It is also part of the eukaryotic pre-mRNA splicesomal RNP apparatus. The crystal structure of the human homologue has been solved (PDB ID: 1E7K, 2OZB).

Protein sequence:

MQIDPRAIPFANEELSLELLNLVKHGASLQAIKRGANEALKQVNRGKAELVIIAADADPIEIVLHLPLAC EDKGVPYVFIGSKNALGRACNVSVPTIVASIGKHDALGNVVAEIVGKVEALV

Links:

_PubMed_
_Wikipedia_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto