Modomics - A Database of RNA Modifications

Full name: tRNA modification GTPase MnmE
Synonym: TrmE
GI: 17232169
Orf:
COG: COG0486
UniProt: Q8YN91
Structures: | 3GEH |
Complex: MnmE/MnmG
Enzyme type: GTPase
Position of modification - modification: t:34 - cmnm5s2U
t:34 - cmnm5U

Comments:

Homologue of E. coli MnmE. Hydrolyses GTP. MnmE works in complex with MnmG (GidA). Catalyzes two independent reactions according to substrate (glycine or ammonium). Crystal structures available only for the G-domain.

Protein sequence:

MAITGTIAAIATAIVPQQGSVGIVRVSGSQAIAIAQTLFDAPGKQVWESHRILYGYIRHPQTRQIVDEALLLLMKAPRSYTREDVVEFHCHGGIIAVQQV
LQLCLESGARLAQPGEFTLRAFLNGRLDLTQAESIADLVGARSPQAAQTALAGLQGKLAHPIRQLRANCLDILAEIEARIDFEEDLPPLDDEAIISDIEN
IAAEISQLLATKDKGELLRTGLKVAIVGRPNVGKSSLLNAWSQSDRAIVTDLPGTTRDVVESQLVVGGIPVQVLDTAGIRETSDQVEKIGVERSRQAANT
ADLVLLTIDAATGWTTGDQEIYEQVKHRPLILVMNKIDLVEKQLITSLEYPENITQIVHTAAAQKQGIDSLETAILEIVQTGKVQAADMDLAINQRQAAA
LTQAKMSLEQVQATITQQLPLDFWTIDLRGAIQALGEITGEEVTESVLDRIFSRFCIGK

Enzymatic activities:

Reaction Substrate Type Position
Um:cmnm5Um tRNA (t)   34
s2U:nm5s2U tRNA (t)   34
se2U:nm5se2U tRNA (t)   34
s2U:cmnm5s2U tRNA (t)   34
se2U:cmnm5se2U tRNA (t)   34
U:nm5U tRNA (t)   34
U:cmnm5U tRNA (t)   34

Publications:

Title Authors Journal Details PubMed Id DOI
Kissing G domains of MnmE monitored by X-ray crystallography and pulse electron paramagnetic resonance spectroscopy. Meyer S, Bohme S, Kruger A, Steinhoff HJ, Klare JP, Wittinghofer A PLoS Biol [details] 19806182 -
Enzymology of tRNA modification in the bacterial MnmEG pathway. Armengod ME, Moukadiri I, Prado S, Ruiz-Partida R, Benitez-Paez A, Villarroya M, Lomas R, Garzon MJ, Martinez-Zamora A, Meseguer S, Navarro-Gonzalez C Biochimie [details] 22386868 -

Links:

_PubMed_

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca