Full name: tRNA-specific 2-thiouridylase mnmA
Synonym: TrmU
GI: 15900060
Orf:
COG: COG0482
UniProt: Q97T38
Structures: | 2HMA |
Complex:
Enzyme type: thiolase
Position of modification - modification: t:34 - s2U
t:34 - mnm5s2U

Comments:

Homologue of E. coli MnmA and yeast or human mitochondrial TrmU (Mtu1). Requires cysteine desulfurase IscS as a sulfur donor and sulfur mediators: TusA, TusBCD and TusE. For more details see the entry for E. coli MnmA.

Protein sequence:

MSDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPY YSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAITLGADYVATGHYARVARDEDGTV HMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLEKPEVRRLAEEAGLSTAKKKDSTGICFIGEKNFKNF LSNYLPAQPGRMMTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYH DSLMSTSLEASQVHFTREMPEEFTLECTAKFRYRQPDSKVTVHVKGEKTEVIFAEPQRAITPGQAVVFYD GEECLGGGLIDNAYRDGQVCQYI

Publications:

Title Authors Journal Details PubMed Id DOI
Enzymology of tRNA modification in the bacterial MnmEG pathway. Armengod ME, Moukadiri I, Prado S, Ruiz-Partida R, Benitez-Paez A, Villarroya M, Lomas R, Garzon MJ, Martinez-Zamora A, Meseguer S, Navarro-Gonzalez C Biochimie [details] 22386868 -

Links:

_Wikipedia_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto