| Full name: |
tRNA 2-thiouridine(34) synthase |
| Synonym: |
yheL |
| GI: |
16131222 |
| Orf: |
|
| COG: |
COG2168 |
| UniProt: |
P45530 |
| Structures: |
|
2D1P |
|
| Complex: |
TusBCD |
Comments:
Part of a TusBCD complex which functions as a heterohexamer (a dimer of the heterotrimer). TusBCD complex participates in sulfur transfer from IscS cystein desulfurase to MnmA protein which participates in mnm5s2U synthesis at tRNA wobble positions. It mediates sulfur relay via a putative persulfide state of the TusD subunit. It transfers sulfur from TusA to TusE.
Protein sequence:
MLHTLHRSPWLTDFAALLRLLSEGDELLLLQDGVTAAVDGNRYLESLRNAPIKVYALNEDLIARGLTGQISNDIILIDYTDFVRLTVKHPSQMAW
Publications:
| Title |
Authors |
Journal |
Details |
PubMed Id |
DOI |
| Mechanistic insights into sulfur relay by multiple sulfur mediators involved in thiouridine biosynthesis at tRNA wobble positions. |
Ikeuchi Y, Shigi N, Kato J, Nishimura A, Suzuki T |
Mol Cell |
[details]
|
16387657
|
-
|
| Structural basis for sulfur relay to RNA mediated by heterohexameric TusBCD complex. |
Numata T, Fukai S, Ikeuchi Y, Suzuki T, Nureki O |
Structure |
[details]
|
16472754
|
-
|
Links:
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact:
Andrea Cappannini - lp.vog.bcmii@ininnappaca