Full name: | tRNA 2-thiouridine(34) synthase |
---|---|
Synonym: | yheN |
GI: | 16131224 |
COG: | COG1553 |
UniProt: | P45532 |
Structures: | | 2D1P | |
Alpha Fold Predicted Structure: | AF-P45532-F1 |
Complex: | TusBCD |
Enzyme type: | sulfurtransferase |
Title: | crystal structure of heterohexameric TusBCD proteins, which are crucial for the tRNA modification |
---|---|
Classification: | TRANSLATION |
Technique: | X-Ray Diffraction |
Resolution: | 2.15 |
R value free: | 0.242 |
R value observed: | 0.209 |
R value work: | 0.209 |
Pdb Files | 2D1P.pdb |
Pdbx/mmCIF Files | 2D1P.cif |
MRFAIVVTGPAYGTQQASSAFQFAQALIADGHELSSVFFYREGVYNANQLTSPASDEFDLVRAWQQLNAQHGVALNICVAAALRRGVVDETEAGRLGLASSNLQQGFTLSGLGALAEASLTCDRVVQF
Part of a TusBCD complex which functions as a heterohexamer (a dimer of the heterotrimer). TusBCD complex participates in sulfur transfer from IscS cystein desulfurase to MnmA protein which participates in mnm5s2U synthesis at tRNA wobble positions. It mediates sulfur relay via a putative persulfide state of the TusD subunit. It transfers sulfur from TusA to TusE.
Enter the variants
Position
Original
Variant
Alpha Fold Pdb Files | AF-P45532-F1.pdb |
Alpha Fold Pdbx/mmCIF Files | AF-P45532-F1.cif |
DSSP Secondary Structures | P45532.dssp |
_PubMed_ |
_EcoCyc_ |