Full name: | tRNA 2-thiouridine synthesizing protein E |
---|---|
Synonym: | yccK |
GI: | 90111197 |
COG: | COG2920 |
UniProt: | P0AB18 |
Structures: | | | |
Alpha Fold Predicted Structure: | AF-P0AB18-F1 |
Enzyme type: | sulfurtransferase |
MLIFEGKEIETDTEGYLKESSQWSEPLAVVIAENEGISLSPEHWEVVRFVRDFYLEFNTSPAIRMLVKAMANKFGEEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI
TusE binds TusBCD complex and stimulates sulfur transfer from TusA to TusD. TusE also interacts with a MnmA-tRNA complex. It is necessary for sulfur transfer from IscS cysteine desulfurase to MnmA protein which participates in mnm5s2U synthesis at tRNA wobble positions.
Enter the variants
Position
Original
Variant
Alpha Fold Pdb Files | AF-P0AB18-F1.pdb |
Alpha Fold Pdbx/mmCIF Files | AF-P0AB18-F1.cif |
DSSP Secondary Structures | P0AB18.dssp |
_PubMed_ |
_EcoCyc_ |