Full name: tRNA 2-thiouridine synthesizing protein E
Synonym: yccK
GI: 90111197
Orf:
COG: COG2920
UniProt: P0AB18
Structures: | |
Complex:
Enzyme type: sulfurtransferase
Position of modification - modification:

Comments:

TusE binds TusBCD complex and stimulates sulfur transfer from TusA to TusD. TusE also interacts with a MnmA-tRNA complex. It is necessary for sulfur transfer from IscS cysteine desulfurase to MnmA protein which participates in mnm5s2U synthesis at tRNA wobble positions.

Protein sequence:

MLIFEGKEIETDTEGYLKESSQWSEPLAVVIAENEGISLSPEHWEVVRFVRDFYLEFNTSPAIRMLVKAM ANKFGEEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI

Publications:

Title Authors Journal Details PubMed Id DOI
Mechanistic insights into sulfur relay by multiple sulfur mediators involved in thiouridine biosynthesis at tRNA wobble positions. Ikeuchi Y, Shigi N, Kato J, Nishimura A, Suzuki T Mol Cell [details] 16387657 -

Links:

_PubMed_
_EcoCyc_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto