Full name: tRNA-specific adenosine deaminase 2
Synonym: ADAT2
GI: 72392897
Orf: Tb927.8.4180
COG: COG0590
UniProt: Q57W17
Structures: | |
Complex: Tad2/3
Enzyme type: deaminase
Position of modification - modification: t:34 - I

Comments:

Tad2 is part of the functional heterodimeric deaminase Tad2/3. At variance with other dimeric ADAT2/3 deaminases, T. brucei Tad2/3 contains only one functional zinc ion, out of the two per dimeric enzyme. The C-terminal end of subunit tbTad2 plays a critical role in tRNA binding, while subunit Tad3 contributes to catalysis - it is not simply a structural component. This tRNA A:I editing enzyme plays a role in both A:I editing in position 34 and C:U editing in position 32 in vivo. In vitro, this A-to-I tRNA deaminase catalyzes also C-to-U deamination of DNA. The A34-to-I34 deamination reaction was tested with T. brucei tRNA-Thr as substrate. However, as other eukaryotic heterodimeric Tad2/3 it also works on other naturally occurring A34-containing tRNA (Alfonzo J. , unpublished data).

Protein sequence:

MVQDTGKDTNLKGTAEANESVVYCDVFMQAALKEATCALEEGEVPVGCVLVKADSSTAAQAQAGDDLALQ KLIVARGRNATNRKGHALAHAEFVAVEELLRQATAGTSENIGGGGNCGAVSQDLADYVLYVVVEPCIMCA AMLLYNRVRKVYFGCTNPRFGGNGTVLSVHNSYKGCSGEDAALIGYESCGGYRAEEAVVLLQQFYRRENT NAPLGKRKRKDLSVV

Publications:

Title Authors Journal Details PubMed Id DOI
A-to-I and C-to-U editing within transfer RNAs. Su AA, Randau L Biochemistry (Mosc) [details] 22022967 -
Determinants of tRNA editing and modification: Avoiding conundrums, affecting function. Paris Z, Fleming IM, Alfonzo JD Semin Cell Dev Biol [details] 22024020 -
A single zinc ion is sufficient for an active Trypanosoma brucei tRNA editing deaminase. Spears JL, Rubio MA, Gaston KW, Wywial E, Strikoudis A, Bujnicki JM, Papavasiliou FN, Alfonzo JD J Biol Chem [details] 21507956 -
The C-terminal end of the Trypanosoma brucei editing deaminase plays a critical role in tRNA binding. Ragone FL, Spears JL, Wohlgamuth-Benedum JM, Kreel N, Papavasiliou FN, Alfonzo JD RNA [details] 21602302 -
An adenosine-to-inosine tRNA-editing enzyme that can perform C-to-U deamination of DNA. Rubio MA, Pastar I, Gaston KW, Ragone FL, Janzen CJ, Cross GA, Papavasiliou FN, Alfonzo JD Proc Natl Acad Sci U S A [details] 17483465 -

Links:

_TriTrypDB_
_GeneDB_
_Wikipedia - Deamination_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto