Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA large subunit methyltransferase A
Synonym:	RrmA, YebH
GI:	549542
Orf:	b1822
COG:	COG2226
UniProt:	P36999
Structures:	\| 1P91 \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	l:745(745) - m1G

Comments:

RlmAI is found only in gram negative bacteria. The enzyme is dimeric and catalyzes the formation of m1G at position 745, in the loop of helix 35 of domain II of the large subunit rRNA. It has a zinc domain and binds two molecules of AdoMet. RlmAI is the ortholog of RlmAII that is found only in certain gram positive bacteria (like Steptococcus).

Protein sequence:

MSFSCPLCHQPLSREKNSYICPQRHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRAFLDAGHYQPLRDAIVAQLRERLDDKATAVLDIGCGEGYYT
HAFADALPEITTFGLDVSKVAIKAAAKRYPQVTFCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPGPRHLMELKGLIYNEVHLHAP
HAEQLEGFTLQQSAELCYPMRLRGDEAVALLQMTPFAWRAKPEVWQTLAAKEVFDCQTDFNIHLWQRSY

Enzymatic activities:

Reaction	Substrate	Type	Position
G:m1G	rRNA (r)	LSU/23S/prokaryotic cytosol	745

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Identification of the rrmA gene encoding the 23S rRNA m1G745 methyltransferase in Escherichia coli and characterization of an m1G745-deficient mutant.	Gustafsson C, Persson BC	J Bacteriol	[details]	9440525	-
Crystal structure of RlmAI: implications for understanding the 23S rRNA G745/G748-methylation at the macrolide antibiotic-binding site.	Das K, Acton T, Chiang Y, Shih L, Arnold E, Montelione GT	Proc Natl Acad Sci U S A	[details]	14999102	-
Methylation of 23S rRNA nucleotide G745 is a secondary function of the RlmAI methyltransferase.	Liu M, Novotny GW, Douthwaite S	RNA	[details]	15388872	-