Full name: tRNA(Ile2) 2-agmatinylcytidine synthase TiaS
Synonym: PF1855
GI: 18978227
Orf:
COG: COG1571
UniProt: Q8TZX0
Structures: | 3U02 |
Complex:
Enzyme type: agmatidine synthase
Position of modification - modification: t:34 - C+

Comments:

Archaeal TiaS catalyzing formation of agmatidine plays the same decoding role as bacterial TilS catalyzing the formation of lysidine (k2C) in the wobble position of tRNAIle(CAU). Moreover in comparison to bacterial TilS, TiaS has an additional function (phosphorylation of C2 atom of the wobble cytidine-34 as well as autophosphorylation of Thr18 of TiaS). For predicted enzymatic activities see the entry for A. fulgidus TiaS.

Protein sequence:

MLIHIGIDDTDSPNGMCTTYIGAILYREISKIAEPLDFPRLIRLNPNVPYKTRGNGAVAMSFKIDEEKIK EVKTLVIRYVRELADIDHENTNPGIVFLIGEVPKELEEFSLRALREHVTIEEAEHVARKVNAEVYKFKLG RGIIGGLAAIGYPLEKFTYELLAYRKREYWGTPRRVIKESVFYADKWSYPFTYDNVDPYKRTVLITPHGK DPVLVGIRGIDVGKILQVFEMIKIEEPIEFFQVYKTNQNTDDHLVVKKIKDVKPYDNVVIRGKVAGKYWE KGRHVFFELEDETGKIRVAAFEPTKKFRNYVRKLLPGDEVIIAGGVKEFEGVLTVNLEKFYPVNLVPKVE YEKPRCPKCGGTMKSKGDYLKCKKCGYKMEKILTPVKRPRDLKKKIYEVPPDARKHISRPLVLPGGEDKI LEAL

Publications:

Title Authors Journal Details PubMed Id DOI
Agmatine-conjugated cytidine in a tRNA anticodon is essential for AUA decoding in archaea. Ikeuchi Y, Kimura S, Numata T, Nakamura D, Yokogawa T, Ogata T, Wada T, Suzuki T, Suzuki T Nat Chem Biol [details] 20139989 -
Structural basis of tRNA agmatinylation essential for AUA codon decoding. Osawa T, Kimura S, Terasaka N, Inanaga H, Suzuki T, Numata T Nat Struct Mol Biol [details] 22002223 -
Biogenesis of 2-agmatinylcytidine catalyzed by the dual protein and RNA kinase TiaS. Terasaka N, Kimura S, Osawa T, Numata T, Suzuki T Nat Struct Mol Biol [details] 22002222 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto