Full name: 7-cyano-7-deazaguanine tRNA-ribosyltransferase
Synonym: PH1116
GI: 14590946
Orf:
COG: COG0343
UniProt: O58843
Structures: | 1J2B | 1IT8 |
Complex:
Enzyme type: transglycosylase
Position of modification - modification: t:15 - preQ1tRNA

Comments:

For more details on possible enzymatic activity see the entry for H. volcanii TgtA.

Protein sequence:

MSRGDKMLKFEIKARDGAGRIGKLEVNGKKIETPAIMPVVNPKQMVVEPKELEKMGFEIIITNSYIIYKD EELRRKALELGIHRMLDYNGIIEVDSGSFQLMKYGSIEVSNREIIEFQHRIGVDIGTFLDIPTPPDAPRE QAVKELEITLSRAREAEEIKEIPMNATIQGSTYTDLRRYAARRLSSMNFEIHPIGGVVPLLESYRFRDVV DIVISSKMALRPDRPVHLFGAGHPIVFALAVAMGVDLFDSASYALYAKDDRYMTPEGTKRLDELDYFPCS CPVCSKYTPQELREMPKEERTRLLALHNLWVIKEEIKRVKQAIKEGELWRLVDERARSHPKLYSAYKRLL EHYTFLEEFEPITKKSALFKISNESLRWPVVRRAKERAKSINERFGELVEHPIFGRVSRYLSLTYPFAQS EAEDDFKIEKPTKEDAIKYVMAIAEYQFGEGASRAFDDAKVELSKTGMPRQVKVNGKRLATVRADDGLLT LGIEGAKRLHRVLPYPRMRVVVNKEAEPFARKGKDVFAKFVIFADPGIRPYDEVLVVNENDELLATGQAL LSGREMIVFQYGRAVKVRKGVE

Publications:

Title Authors Journal Details PubMed Id DOI
Crystal structure of archaeosine tRNA-guanine transglycosylase. Ishitani R, Nureki O, Fukai S, Kijimoto T, Nameki N, Watanabe M, Kondo H, Sekine M, Okada N, Nishimura S, Yokoyama S J Mol Biol [details] 12054814 -
Alternative tertiary structure of tRNA for recognition by a posttranscriptional modification enzyme. Ishitani R, Nureki O, Nameki N, Okada N, Nishimura S, Yokoyama S Cell [details] 12732145 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto