Modomics - A Database of RNA Modifications

Full name: tRNA (guanine(37)-N1)-methyltransferase Trm5b
Synonym: MJ0883
GI: 15669073
Orf:
COG: COG2520
UniProt: Q58293
Structures: | 2ZZM | 2ZZN | 3AY0 | 2YX1 |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:37 - m1G

Comments:



Protein sequence:

MPLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISKKYRKEIDEGLISLSYDVV
GDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVV
DMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAI
KLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK

Enzymatic activities:

Reaction Substrate Type Position
G:m1G tRNA (t) Cys/GCA/prokaryotic cytosol 37
G:m1G tRNA (t) Leu/UAG/prokaryotic cytosol 37

Publications:

Title Authors Journal Details PubMed Id DOI
Mechanism of N-methylation by the tRNA m1G37 methyltransferase Trm5. Christian T, Lahoud G, Liu C, Hoffmann K, Perona JJ, Hou YM RNA [details] 20980671 -
Catalysis by the second class of tRNA(m1G37) methyl transferase requires a conserved proline. Christian T, Evilia C, Hou YM Biochemistry [details] 16768442 -
Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation. Goto-Ito S, Ito T, Kuratani M, Bessho Y, Yokoyama S Nat Struct Mol Biol [details] 19749755 -
Crystal structure of archaeal tRNA(m(1)G37)methyltransferase aTrm5. Goto-Ito S, Ito T, Ishii R, Muto Y, Bessho Y, Yokoyama S Proteins [details] 18384044 -
Conservation of structure and mechanism by Trm5 enzymes. Christian T, Gamper H, Hou YM... RNA [details] 23887145 -

Links:

_PubMed_

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca