Full name: | Non-specific serine/threonine protein kinase |
---|---|
Synonym: | ssoPK5, piD261 |
GI: | 15897362 |
Orf: | sso0433 |
COG: | COG3642 |
UniProt: | Q97ZY9 |
Alpha Fold Predicted Structure: | AF-Q97ZY9-F1 |
Complex: | EKC/KEOPS |
Enzyme type: | kinase predicted |
Position of modification - modification: |
t:37 - t6A |
MEKLRLIKRGAESNIYEGYFLGIHAIFKQRIKKSYRNPELDHKINYERTILEAKIIYTALKNDVNVPAVLFIDPNNYLLVIEYIEGEIVKDIINTNNPTQLLPNIGKRIGELTGKLHNIGIAHGDLTTNNLILSSTNDDIFIIDFGLSRRTQDEEDFATDLHVFLRSLESVHSDFKDIIYDAFIEGYRKIMGRKTDEILELVKDIRMRGRYVEERRKNRSINE
Crenoarcheal Bud32 (here SsoPK5) is a homolog of the p53-related protein kinase from human (hPRPK), Bud32 from yeast and Euryarcheal Bud32. It is an ATPase that is present only in eykaryota and archaea and absent in bacteria. It is part of the so-called EKC/KEOPS.
Alpha Fold Pdb Files | AF-Q97ZY9-F1.pdb   |
Alpha Fold Pdbx/mmCIF Files | AF-Q97ZY9-F1.cif   |
DSSP Secondary Structures | Q97ZY9.dssp   |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
The activity of an ancient atypical protein kinase is stimulated by ADP-ribose in vitro. | Haile JD, Kennelly PJ | Arch Biochem Biophys | [details] | 21527241 | - |
Structure-function analysis of yeast piD261/Bud32, an atypical protein kinase essential for normal cell life. | Facchin S, Lopreiato R, Stocchetto S, Arrigoni G, Cesaro L, Marin O, Carignani G, Pinna LA | Biochem J | [details] | 12023889 | - |
_PubMed_ |