ID Card:

Full name: Non-specific serine/threonine protein kinase
Synonym: ssoPK5, piD261
GI: 15897362
Orf: sso0433
COG: COG3642
UniProt: Q97ZY9
Alpha Fold Predicted Structure: AF-Q97ZY9-F1
Complex: EKC/KEOPS
Enzyme type: kinase predicted
Position of modification - modification: t:37 - t6A



Protein sequence:

MEKLRLIKRGAESNIYEGYFLGIHAIFKQRIKKSYRNPELDHKINYERTILEAKIIYTALKNDVNVPAVLFIDPNNYLLVIEYIEGEIVKDIINTNNPTQLLPNIGKRIGELTGKLHNIGIAHGDLTTNNLILSSTNDDIFIIDFGLSRRTQDEEDFATDLHVFLRSLESVHSDFKDIIYDAFIEGYRKIMGRKTDEILELVKDIRMRGRYVEERRKNRSINE

Comments:

Crenoarcheal Bud32 (here SsoPK5) is a homolog of the p53-related protein kinase from human (hPRPK), Bud32 from yeast and Euryarcheal Bud32. It is an ATPase that is present only in eykaryota and archaea and absent in bacteria. It is part of the so-called EKC/KEOPS.





Alpha Fold Predicted Structure:






Clear Selection and Reset Camera

Protein sequence:


Secondary Structure Alphabet

  • G: 3-turn helix (310helix)
  • H: α-helix
  • I: 𝝅-helix (5 - turn helix)
  • T: Hydrogen Bonded Turn
  • B: β-sheet
  • S: Bend
  • C: Coil (residues not present in any of the above conformations)
  • N: Not assigned

Download PDB Structures & DSSP Secondary Structures:

Alpha Fold Pdb Files   AF-Q97ZY9-F1.pdb  
Alpha Fold Pdbx/mmCIF Files   AF-Q97ZY9-F1.cif  
DSSP Secondary Structures   Q97ZY9.dssp  





Publications:

Title Authors Journal Details PubMed Id DOI
The activity of an ancient atypical protein kinase is stimulated by ADP-ribose in vitro. Haile JD, Kennelly PJ Arch Biochem Biophys [details] 21527241 -
Structure-function analysis of yeast piD261/Bud32, an atypical protein kinase essential for normal cell life. Facchin S, Lopreiato R, Stocchetto S, Arrigoni G, Cesaro L, Marin O, Carignani G, Pinna LA Biochem J [details] 12023889 -

Links:

_PubMed_