Modomics - A Database of RNA Modifications

Full name:
Synonym: MJ0187
GI: 15668359
Orf:
COG: COG1617
UniProt: Q57646
Structures: | 2K8Y | 3ENH |
Complex: EKC/KEOPS
Enzyme type: pseudouridine synthase
Position of modification - modification: t:37 - t6A

Comments:

Absent in bacteria, present only in eykaryota and archaea. Works with other proteins of the KEC/KEOPS complex Bud32, Pcc1 and possibly Gon7.

Protein sequence:

MIIRGIRGARINNEIFNLGLKFQILNADVVATKKHVLHAINQAKTKKPIAKSFWMEILVRASGQRQIHEAIKIIGAKDGNVCLICEDEETFRKIYELIGG
EIDDSVLEINEDKERLIREIFKIRGFGNVVERVLEKIALIELKKE

Publications:

Title Authors Journal Details PubMed Id DOI
Atomic structure of the KEOPS complex: an ancient protein kinase-containing molecular machine. Mao DY, Neculai D, Downey M, Orlicky S, Haffani YZ, Ceccarelli DF, Ho JS, Szilard RK, Zhang W, Ho CS, Wan L, Fares C, Rumpel S, Kurinov I, Arrowsmith CH, Durocher D, Sicheri F Mol Cell [details] 18951093 -

Links:

_PubMed_

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca