Full name: | EKC/KEOPS complex subunit CGI121 |
---|---|
Synonym: | YML036w |
GI: | 154199620 |
COG: | COG1617 |
UniProt: | Q03705 |
Structures: | | 4WW5 | 4WW7 | 4WW9 | 4WWA | 4XAH | |
Alpha Fold Predicted Structure: | AF-Q03705-F1 |
Complex: | EKC/KEOPS |
Enzyme type: | pseudouridine synthase |
Position of modification - modification: |
t:37 - t6A |
Title: | Crystal structure of binary complex Bud32-Cgi121 in complex with AMPP |
---|---|
Classification: | TRANSFERASE |
Technique: | X-Ray Diffraction |
Resolution: | 2.0 |
R value free: | 0.222 |
R value observed: | 0.185 |
R value work: | 0.183 |
Pdb Files | 4WW5.pdb 4WW7.pdb 4WW9.pdb 4WWA.pdb 4XAH.pdb |
Pdbx/mmCIF Files | 4WW5.cif 4WW7.cif 4WW9.cif 4WWA.cif 4XAH.cif |
MVVSIIPQFPDIKVSLALFEQVKNAKEIRSKMSELSTSFAFIDPRLVCSGEQMYSAIYKTLIEVKYNKMRTRNLNSECVLCLSPTSNISDAFLKFGIKDDSSQLICLKFHTNTDDVDKEQLRTIMTSIVKGQEIEFNDDNLSRFYDEALIRKIYKLSDDFKPQDVNGLSRALVDAIQLRGV
Kinase, Endopeptidase, and other Protein of Small size (KEOPS) protein complex consists of the five Bud32, Cgi121, Kae1, and Pcc1 hetero-pentamer protein complex (Zhang et al. 2015 ). Interestingly, this complex is universally conserved among Archaea and Eukarya, despite being absent in bacteria (Daugeron et al. 2011 ). Differently from the archaeal counterpart, eukaryotic KEOPS adopt a linear arrangement in its five protein components (Zhang et al. 2015 ). Cgi121 works in a genetic pathway and interacts with Bud32 (Bianchi & Shore, 2006 ). Telomeres are regions placed at the end of chromosomes composed of repetitive nucleotide sequences and specialized proteins. They organize chromosome replication and are involved in the recruitment of telomeres (Bianchi & Shore, 2006 ), thereby providing the essential cellular chromosome-end protection, and preserving telomere homeostasis (Daugeron et al. 2011 ). Specifically, the deletion of Cgi121, or other KEOPS components, leads to short telomeres. This implies the failure to add telomeres de novo to DNA double-strand breaks. Physiologically, KEOPS complex, moreover, promotes both telomere uncapping ad telomere elongation (Bianchi & Shore, 2006 ). Cgi121 and Bud32 form a protein complex with ADP that binds to the catalytic site of Bud32. This bond is arranged in the typical manner of the Protein Kinase A (PKA) protein family (Zhang et al. 2015 ). KEOPS is moreover required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t637A) in all tRNAs that read ANN codons (Wan et al. 2016 ). Nevertheless, Cgi121 is not required for tRNA modification.
Enter the variants
Position
Original
Variant
Alpha Fold Pdb Files | AF-Q03705-F1.pdb |
Alpha Fold Pdbx/mmCIF Files | AF-Q03705-F1.cif |
DSSP Secondary Structures | Q03705.dssp |
_PubMed_ |