Full name:
Synonym: Cthe_2767
GI: 125975249
Orf:
COG: COG2227
UniProt: A3DJ37
Structures: | 3JWI | 3JWG |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: undefined RNA:3' end - Xm

Comments:

Homodimer. Manganese dependent. Part of RNA repair system. Methylates 3' end of broken RNAs. Unlike eukaryotic Hen1 involved in RNA interference, the bacterial Hen1 is part of an RNA repair and modification system. Animal homologue of Hen1 modifies piRNA and is important for germ cell development.

Protein sequence:

MILTITYTQPPATDLGYLLHKNPSRPQTFELNHGKAHIFYPEATSERCTVALLLDIDPIDLARGKKGSSG EGGLFDYVNDRPYVSSSFMSVAISRVFGTAMSGKCKEKPELAAIKLPLKAKIMMLPCKGGEEIIYRLFEP LGYKVDVEGYMLDEKFPEWGKSRYYTVSLEGEVRVRDLLNHIYVLIPVLDSEKHYWVGEDEIDKLFQHGE GWLVDHPEKELITGRYLIRKKRLVNQALKRLLEASDVVDDENEDDEPLKNEETEKKLNLNQQRLGTVVAV LKSVNAKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSLV YRDKRFSGYDAATVIEVIEHLDENRLQAFEKVLFEFTRPQTVIVSTPNKEYNFHYQNLFEGNLRHRDHRF EWTRKEFETWAVKVAEKYGYSVRFLQIGEIDDEFGSPTQMGVFTL

Enzymatic activities:

Reaction Substrate Type Position
xX:Xm undefined RNA () 3' end

Publications:

Title Authors Journal Details PubMed Id DOI
Active site mapping and substrate specificity of bacterial Hen1, a manganese-dependent 3' terminal RNA ribose 2'O-methyltransferase. Jain R, Shuman S RNA [details] 21205839 -
Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1. Mui Chan C, Zhou C, Brunzelle JS, Huang RH Proc Natl Acad Sci U S A [details] 19822745 -
Bacterial Hen1 is a 3' terminal RNA ribose 2'-O-methyltransferase component of a bacterial RNA repair cassette. Jain R, Shuman S RNA [details] 20007328 -
Probing the substrate specificity of the bacterial Pnkp/Hen1 RNA repair system using synthetic RNAs. Zhang C, Chan CM, Wang P, Huang RH RNA [details] 22190744 -
Reconstituting bacterial RNA repair and modification in vitro. Chan CM, Zhou C, Huang RH Science [details] 19815768 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto