Full name: tRNA dimethylallyltransferase, mitochondrial
Synonym: TRIT1, IPT
GI: 31581534
Orf:
COG: COG0324
UniProt: Q9H3H1
Structures: | |
Complex:
Enzyme type: dimethylallyltransferase
Position of modification - modification: t:37 - i6A

Comments:

Mod5 catalyzes the transfer the delta2-isopropyl group from dimethylallyl diphosphate to the exocyclic N6 of A36A37-containing tRNA (i6A37 formation). Eukaryotic Mod5 is the ortholog of bacterial MiaA. There are no MiaA/Mod5 homologs in Archaea. Homo sapiens derived gene was shown to complement S. cerevisiae mutant lacking Mod5.

Protein sequence:

MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVYEGLDIITNKV SAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVGGTNYYIESLLWKVLVNTKPQ EMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPHDKRKVARSLQVFEETGISHSEFLHRQHTEE GGGPLGGPLKFSNPCILWLHADQAVLDERLDKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIF QSIGFKEFHEYLITEGKCTLETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVS DVSKWEESVLEPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHL NQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV

Enzymatic activities:

Reaction Substrate Type Position
A:i6A tRNA (t) many/many/mitochondrial 37

Publications:

Title Authors Journal Details PubMed Id DOI
Cloning of a human tRNA isopentenyl transferase. Golovko A, Hjalm G, Sitbon F, Nicander B Gene [details] 11111046 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto