Full name: 7-cyano-7-deazaguanine tRNA-ribosyltransferase
Synonym: Tgt, HVO_2001
GI: 13516848
Orf:
COG:
UniProt: Q9C4M3
Structures: | |
Complex:
Enzyme type: transglycosylase
Position of modification - modification: t:15 - G+

Comments:

Structure with tRNA was solved for TgtA from Pyrococcus horikoshii (1J2B).

Protein sequence:

MRDHFELRDGDLAGRIGRLSVPRAGVTVETPALLPVVNPNIDTISPARLESEFGAEILITNSYIIKTNDH LREEALDVGLHEMLDFDGAIMTDSGSFQLAEYGEIDTTTEEILQFQRDIGTDIATPVDIPTPPDVAREQA EADLEITRQALADAEAADTGEMLVNAPVQGSTYPDLREEAGRHADATDLDVFPVGAVVPMMNAYRYDDMV DAVAAAKRGLGVDAPVHLFGAGHPMMLVLAVALGCDLFDSAAYALYARDGRYLTVRGTEHLEDLDYLPCT CPICTEYSPDDLREKGSKRQEQLLAEHNLHVTFAELRRIKQAIRDGDLMELVEERARSHPAMLDGYRALL AHVDQLEREDPASKGAFFYASNESAHRPEVARHHARMDRLTAEGHVLLTEGGVPSGDDFDATWRVVPPFG PFPRSLSETYPLTAEVPERLDRDAYEQAARGVSRLVEENPDAAFTLAHDDWPESALARVPESVELESLSA VSERLGDEASVGGDDGDDGGSASSAE

Enzymatic activities:

Reaction Substrate Type Position
preQ0base:preQ0tRNA tRNA (t)   15

Publications:

Title Authors Journal Details PubMed Id DOI
Biosynthesis of archaeosine, a novel derivative of 7-deazaguanosine specific to archaeal tRNA, proceeds via a pathway involving base replacement on the tRNA polynucleotide chain. Watanabe M, Matsuo M, Tanaka S, Akimoto H, Asahi S, Nishimura S, Katze JR, Hashizume T, Crain PF, McCloskey JA, Okada N J Biol Chem [details] 9242689 -

Links:

_PubMed_
_HaloferaxWiki_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto