Full name: Threonylcarbamoyladenosine tRNA methylthiotransferase
Synonym: tRNA-t(6)A37 methylthiotransferase, Cdkal1
GI: 21617853
Orf:
COG: COG0621
UniProt: Q91WE6
Structures: | |
Complex:
Enzyme type: methylthiotransferase
Position of modification - modification: t:37 - ms2t6A

Comments:

ms2t6A is found at position 37 of tRNA-Lys(UUU) only. Eukaryotic MtaB (Cdkal1) displays C-terminal TRAM domain and 2 [4Fe-4S] clusters), characteristic features of the methylthiotransferase family, a subclass of the large radical AdoMet enzyme superfamily, including B. subtilis MtaB (YqeV) and E. coli or B. subtilis MiaE.

Protein sequence:

MPSASCDVLLDDIEDIISQEDSKPQDRQFSRKHVFPKVRRRNTQKYLQEEPRPPSDSTIPGIQKIWIRTW GCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKVVLAGCVPQ AQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGKRLGGARLDLPKIRKNPLIEIISIN TGCLNACTYCKTKHARGNLASYPIDELVERAKQSFQEGVCEIWLTSEDTGAYGRDIGTDLPTLLWKLVEV IPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPVQSASDSVLMDMKREYCVADFKRVVDFLKE KVPGITIATDIICGFPGETDQDFQETVKLVEEYKFPSLFINQFYPRPGTPAAKAEQVPAHVKKQRTKDLS RVFHSYNPYDHKIGERQQVLVTEESFDSKFYVAHNRFYEQVLVPKNPAFMGKMVEVDIYESGKHFLKGQP VSETRVYTPSISKPLAKGEVSGLTKEFRNRLGNHPNGTSDTCPATQHGSAYSRMVLQMSQYDCALKVATG LALLALLLHFWPDSLLTM

Enzymatic activities:

Reaction Substrate Type Position
t6A:ms2t6A tRNA (t) Lys/SUU/prokaryotic cytosol 37

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of eukaryotic and prokaryotic methylthiotransferase for biosynthesis of 2-methylthio-N6-threonylcarbamoyladenosine in tRNA. Arragain S, Handelman SK, Forouhar F, Wei FY, Tomizawa K, Hunt JF, Douki T, Fontecave M, Mulliez E, Atta M J Biol Chem [details] 20584901 -
Deficit of tRNA(Lys) modification by Cdkal1 causes the development of type 2 diabetes in mice. Wei FY, Suzuki T, Watanabe S, Kimura S, Kaitsuka T, Fujimura A, Matsui H, Atta M, Michiue H, Fontecave M, Yamagata K, Suzuki T, Tomizawa K J Clin Invest [details] 21841312 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto