Title: | |
---|---|
Classification: | |
Technique: | |
Pdb Files | 3BBD.pdb   3BBE.pdb   3BBH.pdb   |
Pdbx/mmCIF Files | 3BBD.cif   3BBE.cif   3BBH.cif   |
MTYNIILAKSALELIPEEIKNKIRKSRVYKYDILDSNYHYKAMEKLKDKEMRGRPDIIHISLLNILDSPINHEKKLNIYIHTYDDKVLKINPETRLPRNYFRFLGVMEKVLKGERNHLIKMEEKTLEDLLNEINAKKIAIMTKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDIKEISIYNKGLMAWTVCGIICYSLSF
Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References |
---|---|---|---|---|---|---|---|---|---|---|
Y:m1Y | RNA | rRNA | 914 | SSU-16S | Prokaryotic Cytosol | 20047967    |
Alpha Fold Pdb Files | AF-Q57977-F1.pdb   |
Alpha Fold Pdbx/mmCIF Files | AF-Q57977-F1.cif   |
DSSP Secondary Structures | Q57977.dssp   |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
The crystal structure of Nep1 reveals an extended SPOUT-class methyltransferase fold and a pre-organized SAM-binding site. | Taylor AB, Meyer B, Leal BZ, Kotter P, Schirf V, Demeler B, Hart PJ, Entian KD, Wohnert J | Nucleic Acids Res | [details] | 18208838 | - |
Backbone resonance assignments of the 48 kDa dimeric putative 18S rRNA-methyltransferase Nep1 from Methanocaldococcus jannaschii. | Wurm JP, Duchardt E, Meyer B, Leal BZ, Kotter P, Entian KD, Wohnert J | Biomol NMR Assign | [details] | 19779849 | - |
The ribosome assembly factor Nep1 responsible for Bowen-Conradi syndrome is a pseudouridine-N1-specific methyltransferase. | Wurm JP, Meyer B, Bahr U, Held M, Frolow O, Kotter P, Engels JW, Heckel A, Karas M, Entian KD, Wohnert J | Nucleic Acids Res | [details] | 20047967 | - |