Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA small subunit methyltransferase Nep1
Synonym:	MJ0557
GI:	20532166
Orf:
COG:	COG1756
UniProt:	Q57977
Structures:	\| 3BBE \| 3BBD \| 3BBH \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	s:914(966) - m1Y

Comments:

Protein sequence:

MTYNIILAKSALELIPEEIKNKIRKSRVYKYDILDSNYHYKAMEKLKDKEMRGRPDIIHISLLNILDSPINHEKKLNIYIHTYDDKVLKINPETRLPRNY
FRFLGVMEKVLKGERNHLIKMEEKTLEDLLNEINAKKIAIMTKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDIKEISIYNKGLMAWTVCGIIC
YSLSF

Enzymatic activities:

Reaction	Substrate	Type	Position
Y:m1Y	rRNA (r)	SSU/16S/prokaryotic cytosol	914

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
The crystal structure of Nep1 reveals an extended SPOUT-class methyltransferase fold and a pre-organized SAM-binding site.	Taylor AB, Meyer B, Leal BZ, Kotter P, Schirf V, Demeler B, Hart PJ, Entian KD, Wohnert J	Nucleic Acids Res	[details]	18208838	-
Backbone resonance assignments of the 48 kDa dimeric putative 18S rRNA-methyltransferase Nep1 from Methanocaldococcus jannaschii.	Wurm JP, Duchardt E, Meyer B, Leal BZ, Kotter P, Entian KD, Wohnert J	Biomol NMR Assign	[details]	19779849	-
The ribosome assembly factor Nep1 responsible for Bowen-Conradi syndrome is a pseudouridine-N1-specific methyltransferase.	Wurm JP, Meyer B, Bahr U, Held M, Frolow O, Kotter P, Engels JW, Heckel A, Karas M, Entian KD, Wohnert J	Nucleic Acids Res	[details]	20047967	-

Links:

_PubMed_

_PubMed_