| Title: | |
|---|---|
| Classification: | |
| Technique: | |
| Pdb Files | 3ENC.pdb   3ENO.pdb   | 
| Pdbx/mmCIF Files | 3ENC.cif   3ENO.cif   | 
MKAKRVQAKIEIEFPSEDVAKVVYEAVLYEHLSVPYRRSEIDFKLEGKKIILDIKATDSSALRGTVNSYLRWIKAAIDVIEV
Absent in Bacteria. Works with other proteins of the EKC/KEOPS complex (Bud32, Cgi121 and possibly Gon7).
| Title | Authors | Journal | Details | ||
|---|---|---|---|---|---|
| Atomic structure of the KEOPS complex: an ancient protein kinase-containing molecular machine. | Mao DY, Neculai D, Downey M, Orlicky S, Haffani YZ, Ceccarelli DF, Ho JS, Szilard RK, Zhang W, Ho CS, Wan L, Fares C, Rumpel S, Kurinov I, Arrowsmith CH, Durocher D, Sicheri F | Mol Cell | [details] | 18951093 | - | 
| _PubMed_ |