Full name:
Synonym: PF2011
GI: 18978383
Orf:
COG: COG2892
UniProt: Q8TZI1
Structures: | 3ENC | 3ENO |
Complex: EKC/KEOPS
Enzyme type: methyltransferase
Position of modification - modification: t:37 - t6A

Comments:

Absent in Bacteria. Works with other proteins of the EKC/KEOPS complex (Bud32, Cgi121 and possibly Gon7).

Protein sequence:

MKAKRVQAKIEIEFPSEDVAKVVYEAVLYEHLSVPYRRSEIDFKLEGKKIILDIKATDSSALRGTVNSYL RWIKAAIDVIEV

Publications:

Title Authors Journal Details PubMed Id DOI
Atomic structure of the KEOPS complex: an ancient protein kinase-containing molecular machine. Mao DY, Neculai D, Downey M, Orlicky S, Haffani YZ, Ceccarelli DF, Ho JS, Szilard RK, Zhang W, Ho CS, Wan L, Fares C, Rumpel S, Kurinov I, Arrowsmith CH, Durocher D, Sicheri F Mol Cell [details] 18951093 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto