Full name: Polarized growth chromatin-associated controller 1
Synonym: YKR095W-A
GI: 398365493
Orf:
COG: COG2892
UniProt: Q3E833
Structures: | |
Complex: EKC/KEOPS
Enzyme type: methyltransferase
Position of modification - modification: t:37 - t6A

Comments:

Absent in Bacteria. Works with other proteins of the EKC/KEOPS complex (Bud32, Cgi121 and possibly Gon7).

Protein sequence:

MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRVGV SSIIDSIKTIVEAMDVLS

Publications:

Title Authors Journal Details PubMed Id DOI
Gcn4 misregulation reveals a direct role for the evolutionary conserved EKC/KEOPS in the t6A modification of tRNAs. Daugeron MC, Lenstra TL, Frizzarin M, El Yacoubi B, Liu X, Baudin-Baillieu A, Lijnzaad P, Decourty L, Saveanu C, Jacquier A, Holstege FC, de Crecy-Lagard V, van Tilbeurgh H, Libri D Nucleic Acids Res [details] 21459853 -

Links:

_PubMed_
_SGD_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto