Full name: 23S rRNA (guanine(748)-N(1))-methyltransferase
Synonym: TlrB
GI: 4210927
Orf:
COG: COG2226
UniProt: Q9S1M6
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:748(748) - m1G

Comments:

RlmA(II) is found only in several groups of gram positive bacteria (Steptomyces and Streptococcus). It catalyzes the formation of m1G at position 748 in the loop of helix 35 of large subunit rRNA. It confers resistance to tylosin and other mycinosylated macrolide antibiotics. In vitro it works on naked 23S rRNA. AdoMet is the donor of methyl group. RlmA(II) is the ortholog of RlmA(I) that is found only in gram negative bacteria (such as E. coli). Methylation site was determined for E. coli rRNA.

Protein sequence:

MRKNVVRYLRCPHCAAPLRSSDRTLRCENGHTFDVARQGYVNLLRRPTKLAADTTDMVAARAALLDSGHY APLTERLAGTAGRAAGAGAPDCVVDIGGGTGHHLARVLEEFEDAEGLLLDMSKPAVRRAARAHPRASSAV ADVWDTLPLRDGAAAMALNVFAPRNPPEIRRILRPGGTLLVVTPQQDHLAELVDALGLLRVRDHKEGRLA EQLAPHFEAVGQERLRTTLRLDHDALGRVVAMGPSSWHQDPDELARRIAELPGIHEVTLSVTFTVCRPLP

Enzymatic activities:

Reaction Substrate Type Position
G:m1G rRNA (r) LSU/23S/prokaryotic cytosol 748

Publications:

Title Authors Journal Details PubMed Id DOI
Interaction of the tylosin-resistance methyltransferase RlmA II at its rRNA target differs from the orthologue RlmA I. Douthwaite S, Jakobsen L, Yoshizawa S, Fourmy D J Mol Biol [details] 18406425 -
Recognition elements in rRNA for the tylosin resistance methyltransferase RlmA(II). Lebars I, Husson C, Yoshizawa S, Douthwaite S, Fourmy D J Mol Biol [details] 17673230 -
The tylosin-resistance methyltransferase RlmA(II) (TlrB) modifies the N-1 position of 23S rRNA nucleotide G748. Douthwaite S, Crain PF, Liu M, Poehlsgaard J J Mol Biol [details] 15046978 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto