Modomics - A Database of RNA Modifications

Full name:	Ribosomal large subunit pseudouridine synthase B
Synonym:
GI:	251757325
Orf:	ypul
COG:	COG1187
UniProt:	P35159
Structures:	\| \|
Complex:
Enzyme type:	pseudouridine synthase
Position of modification - modification:	l:2633(2604) - Y

Comments:

When tested in a heterologous in vitro system, purified recombinant B. subtilis RluB (YpuL) produces pseudouridine at position 552 in E.coli 16S rRNA and at positions 1199, 2605, and 2833 in E. coli 23S rRNA. Of these, only pseudouridine at position 2605 (position 2633 in B. subtilis 23S rRNA) is found naturally in 23S rRNA of both B. subtilis and E. coli. For this reason, B. subtilis RluB has been considered as the homolog of E. coli RluB. Notice, though B. subtilis RluB displays 41% sequence similarity with E.coli RsuA (Y516), it does not catalyze the pseudouridine formation at the conserved U in B. subtilis 23S rRNA corresponding to Y516 in E. coli 23S rRNA. Therefore, at variance with site-specific E. coli RluB (Y2605), the B. subtilis homolog displays an in vitro multi-site specificity at other sites than those normally modified in rRNA of E. coli. The in vivo specificity of B. subtilis RluB has not yet been experimentally verified (March 2012).

Protein sequence:

MERLQKVIAHAGVASRRKAEELIKEGKVKVNGKVVTELGVKVTGSDQIEVNGLKVEREEPVYFLLYKPRGVISAAQDDKGRKVVTDFFKNIPQRIYPIGR
LDYDTSGLLLLTNDGEFANKLMHPKYEIDKTYVAKVKGIPPKELLRKLERGIRLEEGKTAPAKAKLLSLDKKKQTSIIQLTIHEGRNRQVRRMFEAIGHE
VIKLKREEYAFLNLRGLHTGDARELTPHEVKRLRALADHGKNAF

Enzymatic activities:

Reaction	Substrate	Type	Position
U:Y	rRNA (r)	LSU/23S/prokaryotic cytosol	2633

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Cloning and characterization of the 23S RNA pseudouridine 2633 synthase from Bacillus subtilis.	Niu L, Lane BG, Ofengand J	Biochemistry	[details]	9888802	-

Links:

_PubMed_

_PubMed_