Full name: Ribosomal RNA small subunit methyltransferase A
Synonym: At5g66360
GI: 42573814
Orf: AT5G66360
COG: COG0030
UniProt: Q9FK02
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:1914(1518) - m6,6A
s:1915(1519) - m6,6A

Comments:

The nuclear genome of Arabidopsis thaliana encodes three dimethylase/mtTFB-like proteins, one of which is Dim1B. The gene product is imported into mitochondria and catalyzes the formation of two adjacent dimethylated residues (m6,6A, positions 1518 and 1519; E. coli numberings) in the loop of a conserved hairpin near the 3'-end of small subunit rRNA. AdoMet is the methyl group donor.

Protein sequence:

MILRLKDQTLIKINSTRSYLSSLVFRRDSHSQARTKPDHDRRRRGYERDVRIEEKKEHDGLFLCKSKGQH LLTNTRILDSIVRSSDIRPTDTVLEIGPGTGNLTMKLLEAAQNVVAVELDKRMVEILRKRVSDHGFADKL TIIQKDVLKTDFPHFDLVVANIPYNISSPLVAKLVYGSNTFRSATLLLQKEFSRRLLANPGDSDFNRLAV NVKLVADVKFVMDVSKREFVPPPKVDSSVIRITPKEIIPDVNVQEWLAFTRTCFGKKNKTLGSMFRQKKK VMELQSLSAGRHGSNVEVMNQTGGDSDSDVEEDGKDDLLCLDTDASMFKERVIEILRTNGFEEKRPSKLS HRELLHLLSLFNQAGIFFHDITSLQMDLHE

Publications:

Title Authors Journal Details PubMed Id DOI
Comprehensive phylogenetic analysis of evolutionarily conserved rRNA adenine dimethyltransferase suggests diverse bacterial contributions to the nucleus-encoded plastid proteome. Park AK, Kim H, Jin HJ Mol Phylogenet Evol [details] 19017544 -
A mitochondrial rRNA dimethyladenosine methyltransferase in Arabidopsis. Richter U, Kuhn K, Okada S, Brennicke A, Weihe A, Borner T Plant J [details] 19929881 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto