Full name: Ribosomal RNA small subunit methyltransferase A
Synonym: KsgA, Dim1, MJ1029
GI: 15669218
Orf:
COG: COG0030
UniProt: Q58435
Structures: | 3FYD | 3FYC | 3GRR | 3GRU | 3GRV | 3GRY |
Complex:
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

Archaeal RsmA belongs to the bacterial KsgA/eukaryal Dim1 super family of methyltransferases. It dimethylates two very conserved adjacent adenosines (positions 1518 and 1519 in E.coli numbering) in the loop of a conserved hairpin near the 3'-end of small subunit rRNA. AdoMet is the methyl group donor. Identity of the target nucleotides was identified by using a heterologous rRNA substrate.

Protein sequence:

MFKPKKKLGQCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANK LKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAKEGT KDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSV RKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNRGRL

Publications:

Title Authors Journal Details PubMed Id DOI
Recognition of a complex substrate by the KsgA/Dim1 family of enzymes has been conserved throughout evolution. O'Farrell HC, Pulicherla N, Desai PM, Rife JP RNA [details] 16540698 -
Structural and functional divergence within the Dim1/KsgA family of rRNA methyltransferases. Pulicherla N, Pogorzala LA, Xu Z, O Farrell HC, Musayev FN, Scarsdale JN, Sia EA, Culver GM, Rife JP J Mol Biol [details] 19520088 -
Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design. O'Farrell HC, Musayev FN, Scarsdale JN, Rife JP Biochemistry [details] 20163168 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto