Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA small subunit methyltransferase A
Synonym:	KsgA, Dim1, MJ1029
GI:	15669218
Orf:
COG:	COG0030
UniProt:	Q58435
Structures:	\| 3FYD \| 3FYC \| 3GRR \| 3GRU \| 3GRV \| 3GRY \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:

Comments:

Archaeal RsmA belongs to the bacterial KsgA/eukaryal Dim1 super family of methyltransferases. It dimethylates two very conserved adjacent adenosines (positions 1518 and 1519 in E.coli numbering) in the loop of a conserved hairpin near the 3'-end of small subunit rRNA. AdoMet is the methyl group donor. Identity of the target nucleotides was identified by using a heterologous rRNA substrate.

Protein sequence:

MFKPKKKLGQCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVA
NLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAKEGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLR
AIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNRGRL

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Recognition of a complex substrate by the KsgA/Dim1 family of enzymes has been conserved throughout evolution.	O'Farrell HC, Pulicherla N, Desai PM, Rife JP	RNA	[details]	16540698	-
Structural and functional divergence within the Dim1/KsgA family of rRNA methyltransferases.	Pulicherla N, Pogorzala LA, Xu Z, O Farrell HC, Musayev FN, Scarsdale JN, Sia EA, Culver GM, Rife JP	J Mol Biol	[details]	19520088	-
Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.	O'Farrell HC, Musayev FN, Scarsdale JN, Rife JP	Biochemistry	[details]	20163168	-

Links:

_PubMed_

_PubMed_