Full name: Ribosomal RNA small subunit methyltransferase D
Synonym: Rv2966c
GI: 15610103
Orf:
COG: COG0742
UniProt: P95128
Structures: | 3P9N |
Complex:
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

As its E. coli ortholog, M. tuberculosis RsmB uses 30S ribosomes as substrate and methylates G966 in the loop of hairpin 31 of 16S rRNA in vitro. Structure determination of the enzyme shows the protein to be a two-domain structure with a short hairpin domain at the N terminus and a C-terminal domain with the S-adenosylmethionine-MT-Rossmann fold. RsmD and RsmC (catalyzing formation of m2G207) both posses a common MTase domain in the C-terminus (Rossmann-fold) and a variable region in the N-terminus that is related to the YbiN family of MTases (formation of m6A1618 by RlmF). This N-terminal hairpin is a minimalist functional domain that helps Rv2966c in target recognition.

Protein sequence:

MTRIIGGVAGGRRIAVPPRGTRPTTDRVRESLFNIVTARRDLTGLAVLDLYAGSGALGLEALSRGAASVL FVESDQRSAAVIARNIEALGLSGATLRRGAVAAVVAAGTTSPVDLVLADPPYNVDSADVDAILAALGTNG WTREGTVAVVERATTCAPLTWPEGWRRWPQRVYGDTRLELAERLFANV

Publications:

Title Authors Journal Details PubMed Id DOI
Structural and functional characterization of Rv2966c protein reveals an RsmD-like methyltransferase from Mycobacterium tuberculosis and the role of its N-terminal domain in target recognition. Kumar A, Saigal K, Malhotra K, Sinha KM, Taneja B J Biol Chem [details] 21474448 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto