Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA small subunit methyltransferase F
Synonym:	TTHA1387
GI:	55981356
Orf:
COG:	COG0144
UniProt:	Q5SII2
Structures:	\| 3M6U \| 3M6V \| 3M6W \| 3M6X \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	s:1378(1400) - m5C s:1382(1404) - m5C s:1385(1407) - m5C

Comments:

At variance with E. coli site-specific RsmF, which introduces a single m5C1407 modification, the T. thermophilus ortholog is a multisite-specific methyltransferase that modifies three positions, generating m5C1400, m5C1404 and m5C1407 in the 16S rRNA of a 30S subunit substrate. When naked 16S rRNA is tested as substrate, only C1400 and C1404 can be methylated in vitro. These residues, C1400 and C1404, are sufficiently buried in the mature ribosome structure so as to require extensive unfolding of the rRNA to be accessible to RsmF. Moreover, comparison of structures of E. coli and T. thermophilus RsmF reveals that key segments in the active site are likely to be dynamic in solution, thereby expanding substrate recognition by T. thermophilus RsmF

Protein sequence:

MLPKAFLSRMAELLGEEFPAFLKALTEGKRTYGLRVNTLKLPPEAFQRISPWPLRPIPWCQEGFYYPEEARPGPHPFFYAGLYYIQEPSAQAVGVLLDPK
PGERVLDLAAAPGGKTTHLAARMGGKGLLLANEVDGKRVRGLLENVERWGAPLAVTQAPPRALAEAFGTYFHRVLLDAPCSGEGMFRKDREAARHWGPSA
PKRMAEVQKALLAQASRLLGPGGVLVYSTCTFAPEENEGVVAHFLKAHPEFRLEDARLHPLFAPGVPEWGEGNPELLKTARLWPHRLEGEGHFLARFRKE
GGAWSTPRLERPSPLSQEALRAFRGFLEEAGLTLEGPVLDRAGHLYLLPEGLPTLLGLKAPAPGLYLGKVQKGRFLPARALALAFGATLPWPEGLPRLAL
TPEDPRALAFATGEGVAWEGEDHPLALVVLKTAAGEFPLDFGKAKRGVLRPVGVGL

Enzymatic activities:

Reaction	Substrate	Type	Position
C:m5C	rRNA (r)	SSU/16S/prokaryotic cytosol	1379
C:m5C	rRNA (r)	SSU/16S/prokaryotic cytosol	1383
C:m5C	rRNA (r)	SSU/16S/prokaryotic cytosol	1386

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Multi-site-specific 16S rRNA methyltransferase RsmF from Thermus thermophilus.	Demirci H, Larsen LH, Hansen T, Rasmussen A, Cadambi A, Gregory ST, Kirpekar F, Jogl G	RNA	[details]	20558545	-