Full name: Queuine tRNA-ribosyltransferase
Synonym: ZMO0363
GI: 283856241
Orf:
COG: COG0343
UniProt: P28720
Structures: | 1Q2R | 1Q2S | 1WKF |
Complex:
Enzyme type: transglycosylase
Position of modification - modification: t:34 - preQ1tRNA

Comments:

The homologue from E. coli was biochemically characterized.

Protein sequence:

MVEATAQETDRPRFSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGN TYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERS IEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAALFGIQQGSVFENL RQQSADALAEIGFDGYAVGGLAVGEGQDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFD CVLPTRSGRNGQAFTWDGPINIRNARFSEDLTPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHN IAFYQQLMQKIRDSISEGRFSQFAQDFRARYFARNS

Publications:

Title Authors Journal Details PubMed Id DOI
Sequence analysis and overexpression of the Zymomonas mobilis tgt gene encoding tRNA-guanine transglycosylase: purification and biochemical characterization of the enzyme. Reuter K, Ficner R J Bacteriol [details] 7665516 -
Crystal structure of tRNA-guanine transglycosylase: RNA modification by base exchange. Romier C, Reuter K, Suck D, Ficner R EMBO J [details] 8654383 -
Mutagenesis and crystallographic studies of Zymomonas mobilis tRNA-guanine transglycosylase to elucidate the role of serine 103 for enzymatic activity. Gradler U, Ficner R, Garcia GA, Stubbs MT, Klebe G, Reuter K FEBS Lett [details] 10413112 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto