Full name: tRNA(Ile)2-lysidine synthase
Synonym: GK0060
GI: 56418595
Orf:
COG: COG0037
UniProt: Q5L3T3
Structures: | 3A2K | 3HJ7 |
Complex:
Enzyme type: lysidine synthase
Position of modification - modification: t:34 - k2C

Comments:

The activity was tested only in vitro

Protein sequence:

MIDKVRAFIHRHQLLSEGAAVIVGVSGGPDSLALLHVFLSLRDEWKLQVIAAHVDHMFRGRESEEEMEFV KRFCVERRILCETAQIDVPAFQRSAGLGAQEAARICRYRFFAELMEKHQAGYVAVGHHGDDQVETILMRL VRGSTSKGYAGIPVKRPFHGGYLIRPFLAVSRAEIEAYCRQMGLSPRCDPSNEKDDYTRNRFRHHIVPLL RQENPRLHERFQQYSEMMAEDEQFLEELAADALNKVMEKQHRDAALSIGPFLELPRPLQRRVLQLLLLRL YGGVPPTLTSVHIGHILMLCERGRPSGMIDLPKGLKVIRSYDRCLFTFDAESGEKGYWFELPVPALLPLP NGYAIISEFGEHYPRKQAGNDWFVVDPASVSLPLRVRTRRRGDRMVLKGTGGTKKLKEIFIEAKIPRMER DRWPIVEDADGRILWVPGLKKSAFEAQNRGQARYILLQYQAMNS

Enzymatic activities:

Reaction Substrate Type Position
C:k2C tRNA (t) Ile/}AU/prokaryotic cytosol 34

Publications:

Title Authors Journal Details PubMed Id DOI
Structural basis for translational fidelity ensured by transfer RNA lysidine synthetase. Nakanishi K, Bonnefond L, Kimura S, Suzuki T, Ishitani R, Nureki O Nature [details] 19847269 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto