Full name: tRNA (guanine(26)-N(2)/guanine(27)-N(2))-dimethyltransferase
Synonym: aq_841
GI: 15606194
Orf:
COG: COG1867
UniProt: O67010
Structures: | 3AXS | 3AXT |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:26 - m2,2G
t:27 - m2,2G

Comments:

Activity tested in vitro and detected in cell extract.

Protein sequence:

MEIVQEGIAKIIVPEIPKTVSSDMPVFYNPRMRVNRDLAVLGLEYLCKKLGRPVKVADPLSASGIRAIRF LLETSCVEKAYANDISSKAIEIMKENFKLNNIPEDRYEIHGMEANFFLRKEWGFGFDYVDLDPFGTPVPF IESVALSMKRGGILSLTATDTAPLSGTYPKTCMRRYMARPLRNEFKHEVGIRILIKKVIELAAQYDIAMI PIFAYSHLHYFKLFFVKERGVEKVDKLIEQFGYIQYCFNCMNREVVTDLYKFKEKCPHCGSKFHIGGPLW IGKLWDEEFTNFLYEEAQKREEIEKETKRILKLIKEESQLQTVGFYVLSKLAEKVKLPAQPPIRIAVKFF NGVRTHFVGDGFRTNLSFEEVMKKMEELKEKQKEFLEKKKQG

Enzymatic activities:

Reaction Substrate Type Position
G:m2G tRNA (t) many/many/prokaryotic cytosol 26
G:m2G tRNA (t) many/many/prokaryotic cytosol 27
m2G:m2,2G tRNA (t) many/many/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) many/many/prokaryotic cytosol 27

Publications:

Title Authors Journal Details PubMed Id DOI
Substrate tRNA recognition mechanism of a multisite-specific tRNA methyltransferase, Aquifex aeolicus Trm1, based on the X-ray crystal structure. Awai T, Ochi A, Ihsanawati, Sengoku T, Hirata A, Bessho Y, Yokoyama S, Hori H J Biol Chem [details] 21844194 -
Aquifex aeolicus tRNA (N2,N2-guanine)-dimethyltransferase (Trm1) catalyzes transfer of methyl groups not only to guanine 26 but also to guanine 27 in tRNA. Awai T, Kimura S, Tomikawa C, Ochi A, Ihsanawati, Bessho Y, Yokoyama S, Ohno S, Nishikawa K, Yokogawa T, Suzuki T, Hori H J Biol Chem [details] 19491098 -
Identification of Aquifex aeolicus tRNA (m2(2G26) methyltransferase gene. Takeda H, Hori H, Endo Y Nucleic Acids Res Suppl. [details] 12903189 -
Aquifex aeolicus Trm1[tRNA (m2(2)G26) methyltransferase] has a novel recognition mechanism of the substrate RNA. Awai T, Takehara T, Takeda H, Hori H Nucleic Acids Symp Ser (Oxf) [details] 17150754 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto