Full name: tRNA (guanine(26)-N(2))-dimethyltransferase
Synonym: PH1829
GI: 14591578
Orf:
COG: COG1867
UniProt: O59493
Structures: | 2DUL | 2EJT | 2EJU | 2YTZ |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:26 - m2,2G

Comments:

The activity was tested on in vitro transcribed tRNAVal.

Protein sequence:

MVNLELIEVQEGKAKILIPKAESIYDSPVFYNPRMALNRDIVVVLLNILNPKIVLDALSATGIRGIRFAL ETPAEEVWLNDISEDAYELMKRNVMLNFDGELRESKGRAILKGEKTIVINHDDANRLMAERHRYFHFIDL DPFGSPMEFLDTALRSAKRRGILGVTATDGAPLCGAHPRACLRKYLAVPLRGELCHEVGTRILVGVIARY AAKYDLGIDVILAYYKDHYFRAFVKLKDGARKGDETLEKLGYIYFDDKTGKFELEQGFLPTRPNAYGPVW LGPLKDEKIVSKMVKEAESLSLARKKQALKLLKMIDQELDIPLFYDTHAIGRRLKIETKKVEEIISALRE QGYEATRTHFSPTGIKTSAPYEVFIETIKRI

Enzymatic activities:

Reaction Substrate Type Position
G:m2G tRNA (t) Val/unknown/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Val/unknown/prokaryotic cytosol 26

Publications:

Title Authors Journal Details PubMed Id DOI
Crystal structure of tRNA N2,N2-guanosine dimethyltransferase Trm1 from Pyrococcus horikoshii. Ihsanawati, Nishimoto M, Higashijima K, Shirouzu M, Grosjean H, Bessho Y, Yokoyama S J Mol Biol [details] 18789948 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto