Modomics - A Database of RNA Modifications

Full name:	tRNA (guanine(10)-N2)-dimethyltransferase
Synonym:	(Pab)Trm-G10, PYRAB16240
GI:	327488511
Orf:	PAB1283
COG:	COG1041
UniProt:	Q9UY84
Structures:	\| \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	t:10 - m2,2G

Comments:

TrmG10 it is the homolog of yeast Trm11. It catalyses formation of m2G10 or m2,2G10, depending on tRNA substrate. The activity was tested on heterologous substrates.

Protein sequence:

MFYVEILGLLPEMAEAEVKALAELRNGTIKERDYLLVVGNVENVEIFERLGLAHEYGILLGSGDDVRDILDLVRGLEWKEIIKGTFAVRKEVMVNCAHEV
KNLEKIIGGIIHSQGLRVNLSKPDTIIKVYCGRKLWIGIRIREFRGKEFDERKADRRPFSRPIALPPRIARAMVNLTRATREILDPFMGTGGMLIEAGLM
GLKVYGIDIREDMVEGAKINLEYYGVKDYVVKVGDATKIKEAFPGKTFEAIATDPPYGTSTTLPMDRDELYKRALESMYSVLEGRLAIAFPSDFDALDVA
ETIGFKVIGRFYQRVHSSLSRYFYIMEAR

Enzymatic activities:

Reaction	Substrate	Type	Position
G:m2G	tRNA (t)		10
m2G:m2,2G	tRNA (t)		10

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
THUMP from archaeal tRNA:m22G10 methyltransferase, a genuine autonomously folding domain.	Gabant G, Auxilien S, Tuszynska I, Locard M, Gajda MJ, Chaussinand G, Fernandez B, Dedieu A, Grosjean H, Golinelli-Pimpaneau B, Bujnicki JM, Armengaud J	Nucleic Acids Res	[details]	16687654	-
N2-methylation of guanosine at position 10 in tRNA is catalyzed by a THUMP domain-containing, S-adenosylmethionine-dependent methyltransferase, conserved in Archaea and Eukaryota.	Armengaud J, Urbonavicius J, Fernandez B, Chaussinand G, Bujnicki JM, Grosjean H	J Biol Chem	[details]	15210688	-