Full name: tRNA (guanine(10)-N2)-dimethyltransferase
Synonym: (Pab)Trm-G10, PYRAB16240
GI: 327488511
Orf: PAB1283
COG: COG1041
UniProt: Q9UY84
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:10 - m2,2G

Comments:

TrmG10 it is the homolog of yeast Trm11. It catalyses formation of m2G10 or m2,2G10, depending on tRNA substrate. The activity was tested on heterologous substrates.

Protein sequence:

MFYVEILGLLPEMAEAEVKALAELRNGTIKERDYLLVVGNVENVEIFERLGLAHEYGILLGSGDDVRDIL DLVRGLEWKEIIKGTFAVRKEVMVNCAHEVKNLEKIIGGIIHSQGLRVNLSKPDTIIKVYCGRKLWIGIR IREFRGKEFDERKADRRPFSRPIALPPRIARAMVNLTRATREILDPFMGTGGMLIEAGLMGLKVYGIDIR EDMVEGAKINLEYYGVKDYVVKVGDATKIKEAFPGKTFEAIATDPPYGTSTTLPMDRDELYKRALESMYS VLEGRLAIAFPSDFDALDVAETIGFKVIGRFYQRVHSSLSRYFYIMEAR

Enzymatic activities:

Reaction Substrate Type Position
G:m2G tRNA (t) 10
m2G:m2,2G tRNA (t) 10

Publications:

Title Authors Journal Details PubMed Id DOI
THUMP from archaeal tRNA:m22G10 methyltransferase, a genuine autonomously folding domain. Gabant G, Auxilien S, Tuszynska I, Locard M, Gajda MJ, Chaussinand G, Fernandez B, Dedieu A, Grosjean H, Golinelli-Pimpaneau B, Bujnicki JM, Armengaud J Nucleic Acids Res [details] 16687654 -
N2-methylation of guanosine at position 10 in tRNA is catalyzed by a THUMP domain-containing, S-adenosylmethionine-dependent methyltransferase, conserved in Archaea and Eukaryota. Armengaud J, Urbonavicius J, Fernandez B, Chaussinand G, Bujnicki JM, Grosjean H J Biol Chem [details] 15210688 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto