Full name: | tRNA uridine(34) 5-carboxymethylaminomethyl synthesis enzyme |
---|---|
Synonym: | GidA, TrmF |
GI: | 62288115 |
Orf: | b3741 |
COG: | COG0445 |
UniProt: | P0A6U3 |
Structures: | | 3CP2 | 3CES | |
Complex: | MnmG/MnmE |
Enzyme type: | other |
Position of modification - modification: |
t:34 - cmnm5s2U t:34 - mnm5s2U t:34 - cmnm5Um t:34 - mnm5U |
MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQAD RVLYRQAVRTALENQPNLMIFQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLDNYSGGRAGDPPSIPLSRRLRELPLRVGRLKTG TPPRIDARTIDFSVLAQQHGDNPMPVFSFMGNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMYAGVIEGVGPRYCPSIEDKVMRFADRNQHQIFLEPE GLTSNEIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIEYDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKEG WAPARSQAYLGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTEIGRELGLVDDERWARFNEKLENIERERQRLKSTWVTPSAEAAAEVNAHLT APLSREASGEDLLRRPEMTYEKLTTLTPFAPALTDEQAAEQVEIQVKYEGYIARQQDEIEKQLRNENTLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQ ASRISGVTPAAISILLVWLKKQGMLRRSA
Reaction | Substrate | Type | Position |
---|---|---|---|
U:cmnm5U | tRNA (t) | Lys/SUU/prokaryotic cytosol | 34 |
U:nm5U | tRNA (t) | Lys/SUU/prokaryotic cytosol | 34 |
s2U:nm5s2U | tRNA (t) | Lys/SUU/prokaryotic cytosol | 34 |
se2U:nm5se2U | tRNA (t) | 34 | |
s2U:cmnm5s2U | tRNA (t) | Lys/SUU/prokaryotic cytosol | 34 |
se2U:cmnm5se2U | tRNA (t) | 34 | |
Um:cmnm5Um | tRNA (t) | Leu/)AA/prokaryotic cytosol | 34 |
s2U:nm5s2U | tRNA (t) | Glu/SUC/prokaryotic cytosol | 34 |
s2U:cmnm5s2U | tRNA (t) | Glu/SUC/prokaryotic cytosol | 34 |
U:nm5U | tRNA (t) | Glu/SUC/prokaryotic cytosol | 34 |
U:cmnm5U | tRNA (t) | Glu/SUC/prokaryotic cytosol | 34 |
s2U:nm5s2U | tRNA (t) | Gln/$UG/prokaryotic cytosol | 34 |
s2U:cmnm5s2U | tRNA (t) | Gln/$UG/prokaryotic cytosol | 34 |
U:nm5U | tRNA (t) | Gln/$UG/prokaryotic cytosol | 34 |
U:cmnm5U | tRNA (t) | Gln/$UG/prokaryotic cytosol | 34 |
U:cmnm5U | tRNA (t) | Leu/)AA/prokaryotic cytosol | 34 |
U:nm5U | tRNA (t) | Leu/)AA/prokaryotic cytosol | 34 |
U:nm5U | tRNA (t) | Arg/{CU/prokaryotic cytosol | 34 |
U:cmnm5U | tRNA (t) | Arg/{CU/prokaryotic cytosol | 34 |
U:cmnm5U | tRNA (t) | Gly/{CC/prokaryotic cytosol | 34 |
U:nm5U | tRNA (t) | Gly/{CC/prokaryotic cytosol | 34 |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
Further insights into the tRNA modification process controlled by proteins MnmE and GidA of Escherichia coli. | Yim L, Moukadiri I, Bjork GR, Armengod ME | Nucleic Acids Res | [details] | 17062623 | - |
Crystal structures of the conserved tRNA-modifying enzyme GidA: implications for its interaction with MnmE and substrate. | Meyer S, Scrima A, Versées W, Wittinghofer A | J Mol Biol | [details] | 18565343 | - |
Translational misreading: a tRNA modification counteracts a +2 ribosomal frameshift. | Brégeon D, Colot V, Radman M, Taddei F | Genes Dev | [details] | 11544186 | - |
Evolutionarily conserved proteins MnmE and GidA catalyze the formation of two methyluridine derivatives at tRNA wobble positions. | Moukadiri I, Prado S, Piera J, Velázquez-Campoy A, Björk GR, Armengod ME | Nucleic Acids Res | [details] | 19767610 | - |
Enzymology of tRNA modification in the bacterial MnmEG pathway. | Armengod ME, Moukadiri I, Prado S, Ruiz-Partida R, Benitez-Paez A, Villarroya M, Lomas R, Garzon MJ, Martinez-Zamora A, Meseguer S, Navarro-Gonzalez C | Biochimie | [details] | 22386868 | - |
The output of the tRNA modification pathways controlled by the Escherichia coli MnmEG and MnmC enzymes depends on the growth conditions and the tRNA species. | Moukadiri I, Garzon MJ, Bjork GR, Armengod ME... | Nucleic Acids Res | [details] | 24293650 | - |
SAXS analysis of the tRNA-modifying enzyme complex MnmE/MnmG reveals a novel interaction mode and GTP-induced oligomerization. | Fislage M, Brosens E, Deyaert E, Spilotros A, Pardon E, Loris R, Steyaert J, Garcia-Pino A, Versees W... | Nucleic Acids Res | [details] | 24634441 | - |
_PubMed_ |
_EcoCyc_ |