Full name: tRNA (guanine(6)-N2)-methyltransferase
Synonym: Trm14, MJ0438
GI: 15668614
Orf:
COG: COG0116
UniProt: Q57880
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:6 - m2G

Comments:

Distant homologs of Trm14 were also identified in eykaryota known to possess the m2G6 tRNA modification

Protein sequence:

MDYYVTLSPGLEKISKNEIESFGGKIKEIRENKGRIFFSGDLKLIPKINYLSRTIERMNILLHREEIPNI ALDDIYKRVYNIDWTEWIKENQSFAIRPLRAGEHNFTSIDIGRVAGEAVIKSYQRDKNIRLKVNLDEPDV IVRVEVIFDELIVGIDTTGDIALDKRGYRVFNHPAHLNATIASSLVYLSDWKDDEMLLDPMCGSGTIPIE GALMKRNIPPGKFRENKYGFKFIDIFGYELLDKIKKEIVENKNIYKIIGLDKNQKYLDGAKDNAKNAEVL DTIEFICGDATKLHEKFNESDVIIANPPYGIRIGSKRSVKKLYDEFLSSAKEIMHGSSRLIVITAEDKMF KDAIAKNNFEVKEEFNVMFGGLMTRVFYLTL

Enzymatic activities:

Reaction Substrate Type Position
G:m2G tRNA (t) Cys/unknown/prokaryotic cytosol 6

Publications:

Title Authors Journal Details PubMed Id DOI
Formation of m2G6 in Methanocaldococcus jannaschii tRNA catalyzed by the novel methyltransferase Trm14. Menezes S, Gaston KW, Krivos KL, Apolinario EE, Reich NO, Sowers KR, Limbach PA, Perona JJ Nucleic Acids Res [details] 21693558 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto