Modomics - A Database of RNA Modifications

Full name: tRNA (guanine(6)-N2)-methyltransferase
Synonym: Trm14
GI: 46199459
Orf: TTC1157
COG: COG0116
UniProt: Q72IH5
Structures: | 3TMA |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:6 - m2G

Comments:

AdoMet is the methyl group donor.

Protein sequence:

MWLEATTHPGLEDLLLEELSALYPGEGAEVDARKGRVRIPRAWVGEEALGLRLAHHLVLFRARLLLSREDPLGALERAALALPWPELEGAGSFRVEARRE
GEHPFTSPEVERRVGEALHRAYGVPVDLKRPAVRVRVDVRGEEAFLGVQLTERPLSRRFPKAALRGSLTPVLAQALLRLADARPGMRVLDPFTGSGTIAL
EAASTLGPTSPVYAGDLDEKRLGLAREAALASGLSWIRFLRADARHLPRFFPEVDRILANPPHGLRLGRKEGLFHLYWDFLRGALALLPPGGRVALLTLR
PALLKRALPPGFALRHARVVEQGGVYPRVFVLEKL

Enzymatic activities:

Reaction Substrate Type Position
G:m2G tRNA (t) Phe/GAA/prokaryotic cytosol 6

Publications:

Title Authors Journal Details PubMed Id DOI
The open reading frame TTC1157 of Thermus thermophilus HB27 encodes the methyltransferase forming N(2)-methylguanosine at position 6 in tRNA. Roovers M, Oudjama Y, Fislage M, Bujnicki JM, Versees W, Droogmans L RNA [details] 22337946 -
Crystal structures of the tRNA:m2G6 methyltransferase Trm14/TrmN from two domains of life. Fislage M, Roovers M, Tuszynska I, Bujnicki JM, Droogmans L, Versees W... Nucleic Acids Res [details] 22362751 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca