Full name: tRNA N6-threonylcarbamoyladenosine(37) synthesis protein
Synonym: YeaZ
GI: 16129761
Orf:
COG: COG1214
UniProt: P76256
Structures: | 1OKJ |
Complex: TsaBDE
Enzyme type: endopeptidase
Position of modification - modification: t:37 - t6A

Comments:

In bacteria four proteins: TsaC, TsaB, TsaD and TsaE (YrdC, YeaZ, YgjD and YjeE, respectively) are both necessary and sufficient for t6A biosynthesis in vitro. YrdC and YgjD are members of universally conserved families while YeaZ and YjeE are specific to bacteria. TsaB shows homology with YgjD (TsaD) and interacts physically with YjeE (TsaE) and YgjD (TsaD). Together with YjeE, TsaB may also regulate the activity of YgjD.

Protein sequence:

MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQ
GAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQ
MFAEGKTVAVEHAEPVYLRNNVAWKKLPGKE

Publications:

Title Authors Journal Details PubMed Id DOI
Biosynthesis of threonylcarbamoyl adenosine (t6A), a universal tRNA nucleoside. Deutsch C, El Yacoubi B, de Crecy-Lagard V, Iwata-Reuyl D J Biol Chem [details] 22378793 -
Conserved network of proteins essential for bacterial viability. Handford JI, Ize B, Buchanan G, Butland GP, Greenblatt J, Emili A, Palmer T J Bacteriol [details] 19376873 -
Effects on transcription of mutations in ygjD, yeaZ, and yjeE genes, which are involved in a universal tRNA modification in Escherichia coli. Hashimoto C, Sakaguchi K, Taniguchi Y, Honda H, Oshima T, Ogasawara N, Kato J J Bacteriol [details] 21873492 -
Structural analysis of the essential resuscitation promoting factor YeaZ suggests a mechanism of nucleotide regulation through dimer reorganization. Aydin I, Saijo-Hamano Y, Namba K, Thomas C, Roujeinikova A PLoS One [details] 21858042 -
Mechanism of N6-threonylcarbamoyladenonsine (t(6)A) biosynthesis: isolation and characterization of the intermediate threonylcarbamoyl-AMP. Lauhon CT... Biochemistry [details] 23072323 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca