Modomics - A Database of RNA Modifications

Full name:	tRNA pseudouridine synthase Pus10
Synonym:	PusX
GI:	74536148
Orf:
COG:	COG1258
UniProt:	Q8U1R6
Structures:	\| \|
Complex:
Enzyme type:	pseudouridine synthase
Position of modification - modification:	t:54 - Y t:55 - Y

Comments:

Initially discovered as an enzyme specific for the formation of pseudouridine at position 55 in the T-loop of archaeal tRNA (Roovers et al., 2006), it was later shown to also catalyze the formation of pseudouridine at position 54 (Gurha & Gupta 2008). Pus10 is universally found in Archaea and only in few Eukarya, however in this last case the real function of eukaryal Pus10 in still unknown.

Protein sequence:

MILEKAREILEEHQLCNHCLGRLFGKLGKGTNEERGRAIRLLLSMETGKEYKEPEKCELCGGVFNNLDKFAELCIKAAEGIEFETFWVGSRFPEEIEKKE
EEIWRKFRVVSGEKITKEFNRELGKVIAVRYGKTPVKERPDVVFIVEPFSEKVELQVNPIYVAGRYRKLIRGIPQTPAPGFKESIATIICRAFKKHFHGK
CIFKGAGREDVDVRMLGNGRPFVVEIKRPRKRKVNLKDIEEEINQSGKVEVLNLRFITPEEAERILTTRHRKVYEAIVYVKDGITKEEVEKVVKSLKNAE
IKQRTPRRVLNSRADLVRVRKVYDVKGELIDDKHFKLRLVTDGGLYIKELISGDRGRTTPSVSEILGKEAWCEILDVLEVLDDVEGDN

Enzymatic activities:

Reaction	Substrate	Type	Position
U:Y	tRNA (t)		55
U:Y	tRNA (t)		54

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Formation of the conserved pseudouridine at position 55 in archaeal tRNA.	Roovers M, Hale C, Tricot C, Terns MP, Terns RM, Grosjean H, Droogmans L	Nucleic Acids Res	[details]	16920741	-
Archaeal Pus10 proteins can produce both pseudouridine 54 and 55 in tRNA.	Gurha P, Gupta R	RNA	[details]	18952823	-
tRNA binding, positioning and modification by the pseudouridine synthase Pus10.	Kamalampeta R, Keffer-Wilkes LC, Kothe U...	J Mol Biol	[details]	23743107	-