Modomics - A Database of RNA Modifications

Full name:	AdoMet-dependent rRNA methyltransferase SPB1
Synonym:	YCL54W, YCL431
GI:	6226708
Orf:	YCL054W
COG:	COG0293
UniProt:	P25582
Structures:	\| \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	l:2922(2551) - Gm

Comments:

Spb1 methylates the conserved G2922 (2551 in E.coli numbering) in the so-called A-loop (hairpin 92) of the peptidyltransferase center (domain V) in cytoplasmic pre-rRNA of large subunit rRNA into Gm. It also methylates U2921 (2552 in E. coli numbering) into Um, but only when snR52 guide RNA has been disrupted, otherwise U2921 is normally methylated within the nucleolus by Nop1 (snoRNP machinery). AdoMet is the methyl group donor. The human homolog has also been identified (FTSJ3).

Protein sequence:

MGKTQKKNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSWCQVASKLCPVNSLIIGVDIVPMKPMPNVITFQSDITTEDC
RSKLRGYMKTWKADTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQLFEKVEATKPPASRNVSAEIFVVCK
GFKAPKRLDPRLLDPKEVFEELPDGQQNMESKIYNPEKKVRKRQGYEEGDNLLYHETSILDFVRTEDPISMLGEMNKFTIDENDHEWKILKKLKQTTDEF
RSCIEDLKVLGKKDFKMILRWRKIAREILGIEVKDDAKTEIEVVPLTEEEQIEKDLQGLQEKQRLNVKRERRRKNEMKQKELQRMQMNMITPTDIGIEAA
SLGKESLFNLKTAEKTGILNDLAKGKKRMIFTDDELAKDNDIYIDENIMIKDKDSAADADDLESELNAMYSDYKTRRSERDAKFRAKQARGGDNEEEWTG
FNEGSLEKKEEEGKDYIEDNDDEGVEGDSDDDEAITNLISKLKGQEGDHKLSSKARMIFNDPIFNNVEPDLPVNTVNDGIMSSESVGDISKLNKKRKHEE
MHQKQDEADSSDESSSDDSDFEIVANDNASEEFDSDYDSEEEKNQTKKEKHSRDIDIATVEAMTLAHQLALGQKNKHDLVDEGFNRYTFRDTENLPDWFL
EDEKEHSKINKPITKEAAMAIKEKIKAMNARPIKKVAEAKARKRMRAVARLEKIKKKAGLINDDSDKTEKDKAEEISRLMRKVTKKPKTKPKVTLVVASG
RNKGLAGRPKGVKGKYKMVDGVMKNEQRALRRIAKKHHKKK

Enzymatic activities:

Reaction	Substrate	Type	Position
G:Gm	rRNA (r)	all/27S/prokaryotic cytosol	2922
U:Um	rRNA (r)	all/27S/prokaryotic cytosol	2921

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Spb1p-directed formation of Gm2922 in the ribosome catalytic center occurs at a late processing stage.	Lapeyre B, Purushothaman SK	Mol Cell	[details]	15546625	-
Functional redundancy of Spb1p and a snR52-dependent mechanism for the 2'-O-ribose methylation of a conserved rRNA position in yeast.	Bonnerot C, Pintard L, Lutfalla G	Mol Cell	[details]	14636587	-
Spb1p is a putative methyltransferase required for 60S ribosomal subunit biogenesis in Saccharomyces cerevisiae.	Kressler D, Rojo M, Linder P, Cruz J	Nucleic Acids Res	[details]	10556316	-
Spb1p is a yeast nucleolar protein associated with Nop1p and Nop58p that is able to bind S-adenosyl-L-methionine in vitro.	Pintard L, Kressler D, Lapeyre B	Mol Cell Biol	[details]	10648622	-