Modomics - A Database of RNA Modifications

Full name:	tRNA (adenine(58)-N(1))-methyltransferase TrmI
Synonym:	TT_C0244
GI:	46198552
Orf:
COG:	COG2519
UniProt:	Q8GBB2
Structures:	\| 2PWY \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	t:58 - m1A

Comments:

Homologous to M. tuberculosis Rv2118c.

Protein sequence:

MAWPGPLLLKDRKGRAYLVFPKEGGVFHHHKGSVPHEALLEAGPGGVVRTHLGEELSVHRPTLEEYLLHMKRSATPTYPKDASAMVTLLDLAPGMRVLEA
GTGSGGLTLFLARAVGEKGLVESYEARPHHLAQAERNVRAFWQVENVRFHLGKLEEAELEEAAYDGVALDLMEPWKVLEKAALALKPDRFLVAYLPNITQ
VLELVRAAEAHPFRLERVLEVGWREWEVRLPVAHPRFQQVGHTAFLVALRRWKAS

Enzymatic activities:

Reaction	Substrate	Type	Position
A:m1A	tRNA (t)	Asp/GUC/prokaryotic cytosol	58

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Structural comparison of tRNA m(1)A58 methyltransferases revealed different molecular strategies to maintain their oligomeric architecture under extreme conditions.	Guelorget A, Barraud P, Tisne C, Golinelli-Pimpaneau B	BMC Struct Biol	[details]	22168821	-
Cloning and characterization of tRNA (m1A58) methyltransferase (TrmI) from Thermus thermophilus HB27, a protein required for cell growth at extreme temperatures.	Droogmans L, Roovers M, Bujnicki JM, Tricot C, Hartsch T, Stalon V, Grosjean H	Nucleic Acids Res	[details]	12682365	-
Crystal structure of Thermus thermophilus tRNA m1A58 methyltransferase and biophysical characterization of its interaction with tRNA.	Barraud P, Golinelli-Pimpaneau B, Atmanene C, Sanglier S, Van Dorsselaer A, Droogmans L, Dardel F, Tisne C	J Mol Biol	[details]	18262540	-
Substrate tRNA recognition mechanism of eubacterial tRNA (m1A58) methyltransferase (TrmI).	Takuma H, Ushio N, Minoji M, Kazayama A, Shigi N, Hirata A, Tomikawa C, Ochi A, Hori H	J Biol Chem.	[details]	25593312	10.1074/jbc.M114.606038