Modomics - A Database of RNA Modifications

ID Card:

Full name: tRNA (adenine(58)-N(1))-methyltransferase TrmI
Synonym: Rv2118c, MT2178
GI: 81669088
COG: COG2519
UniProt: O33253
Structures: | 1I9G |
Enzyme type: methyltransferase
Position of modification - modification: t:58 - m1A


PDB Structures:


1I9G

Structure Description:

Title:
Classification:
Technique:

Abstract of the PDB Structure's related Publication:

Rv2118c belongs to the class of conserved hypothetical proteins from Mycobacterium tuberculosis H37Rv. The crystal structure of Rv2118c in complex with S-adenosyl-l-methionine (AdoMet) has been determined at 1.98 A resolution. The crystallographic asymmetric unit consists of a monomer, but symmetry-related subunits interact extensively, leading to a tetrameric structure. The structure of the monomer can be divided functionally into two domains: the larger catalytic C-terminal domain that binds the cofactor AdoMet and is involved in the transfer of methyl group from AdoMet to the substrate and a smaller N-terminal domain. The structure of the catalytic domain is very similar to that of other AdoMet-dependent methyltransferases. The N-terminal domain is primarily a beta-structure with a fold not found in other methyltransferases of known structure. Database searches reveal a conserved family of Rv2118c-like proteins from various organisms. Multiple sequence alignments show several regions of high sequence similarity (motifs) in this family of proteins. Structure analysis and homology to yeast Gcd14p suggest that Rv2118c could be an RNA methyltransferase, but further studies are required to establish its functional role conclusively.

Download RCSB-PDB Structures:

Pdb Files   1I9G.pdb  
Pdbx/mmCIF Files   1I9G.cif  


Protein sequence:

MSATGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVAPAPLGRKREGRDG

Comments:

Homologous to yeast Gcd14 (Trm61) and T. thermophilus TmrI. S-adenosyl-L-methionine is the methyl group donor. Homotetramer.




Reaction Substrate SubstrateType Position (Anti)Codon Modified (Anti)Codon Amino Acid Change Transcript Name Transcript Region Cellular Localization References
A:m1A tRNA (t) many/many/prokaryotic cytosol 58 14960715   



Publications:

Title Authors Journal Details PubMed Id DOI
Structural comparison of tRNA m(1)A58 methyltransferases revealed different molecular strategies to maintain their oligomeric architecture under extreme conditions. Guelorget A, Barraud P, Tisne C, Golinelli-Pimpaneau B BMC Struct Biol [details] 22168821 -
Mycobacterium tuberculosis Rv2118c codes for a single-component homotetrameric m1A58 tRNA methyltransferase. Varshney U, Ramesh V, Madabushi A, Gaur R, Subramanya HS, RajBhandary UL Nucleic Acids Res [details] 14960715 -
Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv. Gupta A, Kumar PH, Dineshkumar TK, Varshney U, Subramanya HS J Mol Biol [details] 11554794 -