Title: | |
---|---|
Classification: | |
Technique: | |
Pdb Files | 1I9G.pdb   |
Pdbx/mmCIF Files | 1I9G.cif   |
MSATGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVAPAPLGRKREGRDG
Homologous to yeast Gcd14 (Trm61) and T. thermophilus TmrI. S-adenosyl-L-methionine is the methyl group donor. Homotetramer.
Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References |
---|---|---|---|---|---|---|---|---|---|---|
A:m1A | tRNA (t) | many/many/prokaryotic cytosol | 58 | 14960715    |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
Structural comparison of tRNA m(1)A58 methyltransferases revealed different molecular strategies to maintain their oligomeric architecture under extreme conditions. | Guelorget A, Barraud P, Tisne C, Golinelli-Pimpaneau B | BMC Struct Biol | [details] | 22168821 | - |
Mycobacterium tuberculosis Rv2118c codes for a single-component homotetrameric m1A58 tRNA methyltransferase. | Varshney U, Ramesh V, Madabushi A, Gaur R, Subramanya HS, RajBhandary UL | Nucleic Acids Res | [details] | 14960715 | - |
Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv. | Gupta A, Kumar PH, Dineshkumar TK, Varshney U, Subramanya HS | J Mol Biol | [details] | 11554794 | - |